StarFunc result for job id P29466

User Input

>input (404 residues)
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29466	1.000	1.000	2.880E-81	404	1.000	1.000	P29466.pdb.gz	CASP1_HUMAN Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1
2	AFDB:P29452	0.660	0.663	2.871E-58	402	0.616	0.619	P29452.pdb.gz	CASP1_MOUSE Caspase-1 OS=Mus musculus OX=10090 GN=Casp1 PE=1 SV=1
3	AFDB:P43527	0.611	0.614	2.377E-57	402	0.624	0.627	P43527.pdb.gz	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
4	AFDB:O75601	0.604	0.646	9.249E-44	377	0.460	0.493	O75601.pdb.gz	CASPD_BOVIN Caspase-13 OS=Bos taurus OX=9913 GN=CASP13 PE=1 SV=1
5	AFDB:P51878	0.607	0.565	6.808E-43	434	0.450	0.419	P51878.pdb.gz	CASP5_HUMAN Caspase-5 OS=Homo sapiens OX=9606 GN=CASP5 PE=1 SV=3
6	AFDB:P49662	0.627	0.667	1.529E-41	377	0.473	0.507	P49662.pdb.gz	CASP4_HUMAN Caspase-4 OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
7	AFDB:P70343	0.604	0.653	1.998E-39	373	0.396	0.429	P70343.pdb.gz	CASP4_MOUSE Caspase-4 OS=Mus musculus OX=10090 GN=Casp4 PE=1 SV=2
8	AFDB:Q920D5	0.604	0.582	3.594E-39	420	0.423	0.407	Q920D5.pdb.gz	CASPC_RAT Caspase-12 OS=Rattus norvegicus OX=10116 GN=Casp12 PE=1 SV=1
9	AFDB:E9PSM0	0.603	0.683	5.749E-39	356	0.391	0.444	E9PSM0.pdb.gz	E9PSM0_RAT Caspase 4 OS=Rattus norvegicus OX=10116 GN=Casp4 PE=3 SV=4
10	AFDB:O08736	0.611	0.590	9.078E-38	419	0.406	0.391	O08736.pdb.gz	CASPC_MOUSE Caspase-12 OS=Mus musculus OX=10090 GN=Casp12 PE=1 SV=1
11	PDB:4fdlB	0.489	0.815	7.745E-18	239	0.146	0.247	4fdlB.pdb.gz
12	PDB:4pryA	0.496	0.793	1.458E-16	249	0.176	0.285	4pryA.pdb.gz	Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
13	PDB:4nblA	0.492	0.759	2.442E-15	258	0.163	0.256	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
14	PDB:4iyrB	0.433	0.891	3.544E-12	191	0.134	0.283	4iyrB.pdb.gz
15	PDB:2wdpD	0.438	0.741	4.226E-12	230	0.163	0.287	2wdpD.pdb.gz
16	PDB:7wzsB	0.449	0.858	1.367E-11	206	0.116	0.228	7wzsB.pdb.gz
17	PDB:1dgnA	0.204	0.871	2.446E-6	89	0.111	0.506	1dgnA.pdb.gz
18	PDB:5juyB	0.193	0.066	1.601E-5	1234	0.111	0.036	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
19	PDB:4af8A	0.358	0.422	6.946E-5	333	0.099	0.120	4af8A.pdb.gz
20	PDB:4fguA	0.318	0.316	1.884E-4	407	0.074	0.074	4fguA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P29466	0.0	846	404	1.000	1.000	CASP1_HUMAN Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1
2	P43527	3.13e-177	501	402	0.629	0.632	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
3	P29452	1.09e-176	500	402	0.621	0.624	CASP1_MOUSE Caspase-1 OS=Mus musculus OX=10090 GN=Casp1 PE=1 SV=1
4	P49662	3.76e-127	373	377	0.490	0.525	CASP4_HUMAN Caspase-4 OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
5	O75601	7.53e-121	357	377	0.475	0.509	CASPD_BOVIN Caspase-13 OS=Bos taurus OX=9913 GN=CASP13 PE=1 SV=1
6	P51878	1.06e-115	346	434	0.475	0.442	CASP5_HUMAN Caspase-5 OS=Homo sapiens OX=9606 GN=CASP5 PE=1 SV=3
7	Q920D5	1.90e-108	327	420	0.450	0.433	CASPC_RAT Caspase-12 OS=Rattus norvegicus OX=10116 GN=Casp12 PE=1 SV=1
8	O08736	2.50e-104	316	419	0.428	0.413	CASPC_MOUSE Caspase-12 OS=Mus musculus OX=10090 GN=Casp12 PE=1 SV=1
9	P70343	4.77e-100	304	373	0.411	0.445	CASP4_MOUSE Caspase-4 OS=Mus musculus OX=10090 GN=Casp4 PE=1 SV=2
10	Q3MHS1	8.03e-100	303	373	0.408	0.442	Q3MHS1_RAT Caspase 4, apoptosis-related cysteine peptidase OS=Rattus norvegicus OX=10116 GN=Casp4 PE=2 SV=1
11	E9PSM0	1.81e-99	303	400	0.401	0.405	E9PSM0_RAT Caspase 4 OS=Rattus norvegicus OX=10116 GN=Casp4 PE=3 SV=4
12	Q6UXS9	8.31e-92	281	341	0.337	0.399	CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens OX=9606 GN=CASP12 PE=2 SV=3
13	A0A060XPX2	5.14e-83	259	353	0.401	0.459	A0A060XPX2_ONCMY Caspase-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039688001 PE=3 SV=1
14	O42284	5.84e-76	239	283	0.312	0.445	O42284_CHICK Caspase-1 OS=Gallus gallus OX=9031 PE=2 SV=1
15	Q5EG05	8.07e-71	223	197	0.287	0.589	CAR16_HUMAN Caspase recruitment domain-containing protein 16 OS=Homo sapiens OX=9606 GN=CARD16 PE=1 SV=1
16	Q9I9L7	4.78e-61	204	383	0.297	0.313	CASPA_DANRE Caspase a OS=Danio rerio OX=7955 GN=caspa PE=1 SV=1
17	Q5XLA6	4.70e-53	174	110	0.220	0.809	CAR17_HUMAN Putative caspase recruitment domain-containing protein 17P OS=Homo sapiens OX=9606 GN=CARD17P PE=5 SV=1
18	Q504J1	5.44e-46	165	404	0.250	0.250	CASPB_DANRE Caspase b OS=Danio rerio OX=7955 GN=caspb PE=1 SV=1
19	W0TYK3	6.57e-39	140	213	0.235	0.446	W0TYK3_ONCMY Caspase 1b (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=casp1b PE=2 SV=1
20	P29594	3.76e-28	117	452	0.208	0.186	CASP2_MOUSE Caspase-2 OS=Mus musculus OX=10090 GN=Casp2 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	4.1e-21	86.1	Caspase recruitment domain
2	PF12646 DUF3783	3.2e+02	12.7	Domain of unknown function (DUF3783)
3	PF00656 Peptidase_C14	4e-45	165.9	Caspase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000433138

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219596	0.999	Pyrin
2	9606.ENSP00000247470	0.999	Apoptosis-associated speck-like protein containing a CARD
3	9606.ENSP00000263341	0.999	Interleukin-1 beta
4	9606.ENSP00000337383	0.999	NACHT, LRR and PYD domains-containing protein 3
5	9606.ENSP00000357112	0.999	Interferon-inducible protein AIM2
6	9606.ENSP00000385090	0.999	NLR family CARD domain-containing protein 4
7	9606.ENSP00000478516	0.999	NACHT, LRR and PYD domains-containing protein 1
8	9606.ENSP00000433209	0.998	Gasdermin-D
9	9606.ENSP00000280357	0.997	Interleukin-18
10	9606.ENSP00000375767	0.996	Caspase recruitment domain-containing protein 8
11	9606.ENSP00000300589	0.990	Nucleotide-binding oligomerization domain-containing protein 2
12	9606.ENSP00000263339	0.981	Interleukin-1 alpha
13	9606.ENSP00000222823	0.973	Nucleotide-binding oligomerization domain-containing protein 1
14	9606.ENSP00000269305	0.971	Cellular tumor antigen p53
15	9606.ENSP00000370842	0.968	Interleukin-33
16	9606.ENSP00000357113	0.967	Gamma-interferon-inducible protein 16
17	9606.ENSP00000364859	0.965	Caspase recruitment domain-containing protein 17
18	9606.ENSP00000388566	0.965	Caspase-4
19	9606.ENSP00000309767	0.963	NACHT, LRR and PYD domains-containing protein 6
20	9606.ENSP00000216336	0.953	Cathepsin G

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004197	1.000	cysteine-type endopeptidase activity
GO:0019904	0.999	protein domain specific binding
GO:0140677	0.972	molecular function activator activity
GO:0019899	0.954	enzyme binding
GO:0008047	0.952	enzyme activator activity
GO:0042802	0.942	identical protein binding
GO:0016504	0.617	peptidase activator activity
GO:0016505	0.606	peptidase activator activity involved in apoptotic process
GO:0043028	0.585	cysteine-type endopeptidase regulator activity involved in apoptotic process
GO:0019900	0.565	kinase binding
GO:0008656	0.565	cysteine-type endopeptidase activator activity involved in apoptotic process
GO:0002020	0.385	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050896	0.982	response to stimulus
GO:0050794	0.978	regulation of cellular process
GO:0048518	0.975	positive regulation of biological process
GO:0006950	0.971	response to stress
GO:0012501	0.969	programmed cell death
GO:0042221	0.953	response to chemical
GO:0048522	0.949	positive regulation of cellular process
GO:0019222	0.945	regulation of metabolic process
GO:0060255	0.941	regulation of macromolecule metabolic process
GO:0009893	0.935	positive regulation of metabolic process
GO:0009605	0.934	response to external stimulus
GO:0010604	0.925	positive regulation of macromolecule metabolic process
GO:0051716	0.922	cellular response to stimulus
GO:0071704	0.919	organic substance metabolic process
GO:0044238	0.909	primary metabolic process
GO:0010033	0.907	response to organic substance
GO:0006915	0.906	apoptotic process
GO:0006952	0.898	defense response
GO:0001817	0.897	regulation of cytokine production
GO:0023051	0.890	regulation of signaling
GO:0044419	0.888	biological process involved in interspecies interaction between organisms
GO:0009607	0.888	response to biotic stimulus
GO:0051707	0.884	response to other organism
GO:0007154	0.883	cell communication
GO:0006807	0.883	nitrogen compound metabolic process
GO:0043170	0.876	macromolecule metabolic process
GO:0001819	0.868	positive regulation of cytokine production
GO:0010646	0.864	regulation of cell communication
GO:0019538	0.848	protein metabolic process
GO:0043122	0.834	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032103	0.827	positive regulation of response to external stimulus
GO:0023052	0.826	signaling
GO:0050727	0.826	regulation of inflammatory response
GO:0032496	0.824	response to lipopolysaccharide
GO:0031349	0.821	positive regulation of defense response
GO:0050729	0.810	positive regulation of inflammatory response
GO:0098542	0.808	defense response to other organism
GO:0032652	0.806	regulation of interleukin-1 production
GO:0071216	0.802	cellular response to biotic stimulus
GO:0007165	0.802	signal transduction
GO:0080090	0.783	regulation of primary metabolic process
GO:0051171	0.783	regulation of nitrogen compound metabolic process
GO:0032651	0.783	regulation of interleukin-1 beta production
GO:0002376	0.771	immune system process
GO:0043123	0.755	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0060759	0.749	regulation of response to cytokine stimulus
GO:0032731	0.732	positive regulation of interleukin-1 beta production
GO:0006508	0.727	proteolysis
GO:0071260	0.707	cellular response to mechanical stimulus
GO:0071310	0.692	cellular response to organic substance
GO:1901701	0.676	cellular response to oxygen-containing compound
GO:0016485	0.655	protein processing
GO:0071396	0.613	cellular response to lipid
GO:0065009	0.591	regulation of molecular function
GO:0044093	0.582	positive regulation of molecular function
GO:0051173	0.580	positive regulation of nitrogen compound metabolic process
GO:0051336	0.567	regulation of hydrolase activity
GO:0051246	0.566	regulation of protein metabolic process
GO:0051247	0.551	positive regulation of protein metabolic process
GO:0010941	0.549	regulation of cell death
GO:0043085	0.540	positive regulation of catalytic activity
GO:0030162	0.536	regulation of proteolysis
GO:0052548	0.519	regulation of endopeptidase activity
GO:0032501	0.518	multicellular organismal process
GO:0051345	0.461	positive regulation of hydrolase activity
GO:0002682	0.446	regulation of immune system process
GO:0043067	0.427	regulation of programmed cell death
GO:0031323	0.426	regulation of cellular metabolic process
GO:2000116	0.421	regulation of cysteine-type endopeptidase activity
GO:0045862	0.404	positive regulation of proteolysis
GO:0010952	0.385	positive regulation of peptidase activity
GO:0006955	0.382	immune response
GO:2001056	0.378	positive regulation of cysteine-type endopeptidase activity
GO:0002684	0.373	positive regulation of immune system process
GO:0042981	0.343	regulation of apoptotic process
GO:0034097	0.326	response to cytokine
GO:0032502	0.308	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0016020	0.980	membrane
GO:0043227	0.978	membrane-bounded organelle
GO:0043229	0.978	intracellular organelle
GO:0043231	0.968	intracellular membrane-bounded organelle
GO:0005576	0.964	extracellular region
GO:0071944	0.955	cell periphery
GO:0005886	0.878	plasma membrane
GO:0005615	0.834	extracellular space
GO:0061702	0.737	inflammasome complex
GO:0012505	0.715	endomembrane system
GO:1902494	0.607	catalytic complex
GO:1905369	0.594	endopeptidase complex
GO:0005634	0.379	nucleus
GO:0031982	0.378	vesicle
GO:1904090	0.375	peptidase inhibitor complex
GO:0008303	0.372	caspase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.

[back to server]