StarFunc result for job id P29474

User Input

>input (1203 residues)
MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLT
QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP
EQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRN
APRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGD
FRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDDPP
ELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMST
EIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDH
HAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPW
KGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGR
LFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSS
PRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHF
CAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAA
RDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATIRSVENLQSSKSTRATIL
VRLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGGP
PPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRRY
EEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSTHPGEIHLTVAVL
AYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAP
FRGFWQERLHDIESKGLQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSRE
PDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGDMELD
EAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDPPGSDT
NSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IQG7	0.905	0.764	0.000	1431	0.559	0.470	A0A0R4IQG7.pdb.gz	A0A0R4IQG7_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=nNOS PE=1 SV=1
2	AFDB:A2BIN8	0.477	0.530	0.000	1079	0.456	0.509	A2BIN8.pdb.gz	A2BIN8_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosa PE=3 SV=1
3	AFDB:A9JNR5	0.464	0.516	0.000	1077	0.456	0.510	A9JNR5.pdb.gz	A9JNR5_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosb PE=2 SV=1
4	AFDB:P29475	0.899	0.756	0.000	1434	0.571	0.479	P29475.pdb.gz	NOS1_HUMAN Nitric oxide synthase 1 OS=Homo sapiens OX=9606 GN=NOS1 PE=1 SV=2
5	AFDB:P35228	0.429	0.445	0.000	1153	0.482	0.503	P35228.pdb.gz	NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo sapiens OX=9606 GN=NOS2 PE=1 SV=2
6	AFDB:Q06518	0.411	0.430	0.000	1147	0.485	0.508	Q06518.pdb.gz	NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus OX=10116 GN=Nos2 PE=1 SV=2
7	AFDB:Q27571	0.838	0.750	0.000	1349	0.461	0.411	Q27571.pdb.gz	NOS_DROME Nitric oxide synthase OS=Drosophila melanogaster OX=7227 GN=Nos PE=1 SV=3
8	AFDB:Q6Y5E2	0.875	0.871	0.000	1209	0.961	0.956	Q6Y5E2.pdb.gz	Q6Y5E2_RABIT Nitric oxide synthase OS=Oryctolagus cuniculus OX=9986 PE=2 SV=1
9	AFDB:Q90WQ9	0.458	0.498	0.000	1100	0.461	0.504	Q90WQ9.pdb.gz	Q90WQ9_ONCMY Nitric oxide synthase OS=Oncorhynchus mykiss OX=8022 GN=NOS2 PE=3 SV=1
10	AFDB:Q156E2	0.355	0.553	6.310E-72	761	0.289	0.457	Q156E2.pdb.gz	Q156E2_ONCMY nitric-oxide synthase (NADPH) (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
11	PDB:6j79A	0.352	0.503	6.847E-48	816	0.176	0.260	6j79A.pdb.gz	Crystal structure of a NADPH-cytochrome P450 oxidoreductase (CYPOR) and heme oxygenase 1 fusion protein implies a conformational change in CYPOR upon NADPH/NADP+binding.
12	PDB:5gxuA	0.375	0.764	2.210E-46	552	0.151	0.330	5gxuA.pdb.gz	Structure of the Arabidopsis thaliana NADPH-cytochrome P450 reductase 2 (ATR2) provides insight into its function
13	PDB:2bf4A	0.432	0.776	1.201E-41	645	0.140	0.262	2bf4A.pdb.gz	A Second Fmn-Binding Site in Yeast Nadph-Cytochrome P450 Reductase Suggests a Mechanism of Electron Transfer by Diflavin Reductases.
14	PDB:4d3iA	0.293	0.960	7.007E-41	363	0.129	0.427	4d3iA.pdb.gz	Structure-Based Design of Bacterial Nitric Oxide Synthase Inhibitors.
15	PDB:7suzA	0.294	0.874	2.324E-33	389	0.114	0.352	7suzA.pdb.gz	Functional and structural insight into the flexibility of cytochrome P450 reductases from Sorghum bicolor and its implications for lignin composition.
16	PDB:3lvbA	0.207	0.759	4.813E-16	311	0.070	0.270	3lvbA.pdb.gz	Biochemical and crystallographic characterization of ferredoxin-NADP(+) reductase from nonphotosynthetic tissues
17	PDB:1gvhA	0.164	0.454	1.360E-8	396	0.047	0.144	1gvhA.pdb.gz	The X-Ray Structure of Ferric Escherichia Coli Flavohemoglobin Reveals an Unexpected Geometry of the Distal Heme Pocket
18	PDB:7xk3F	0.180	0.485	4.905E-8	408	0.043	0.127	7xk3F.pdb.gz	Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.
19	PDB:1cqxA	0.169	0.427	1.284E-7	403	0.062	0.186	1cqxA.pdb.gz	Crystal structure of the flavohemoglobin from Alcaligenes eutrophus at 1.75 A resolution.
20	PDB:7romA	0.165	0.703	1.590E-7	255	0.039	0.184	7romA.pdb.gz	Crystal structure of Saccharomyces cerevisiae NADH-cytochrome b5 reductase 1 (Cbr1) fragment (residues 28-284) bound to FAD

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060XV60	1108	1083	0.458	0.509	A0A060XV60_ONCMY Nitric oxide synthase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00018385001 PE=3 SV=1
2	A0A0R4IQG7	1407	1431	0.554	0.466	A0A0R4IQG7_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=nNOS PE=1 SV=1
3	A2BIN8	1146	1079	0.459	0.512	A2BIN8_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosa PE=3 SV=1
4	A7WK81	1145	1079	0.459	0.512	A7WK81_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=NOS2 PE=2 SV=1
5	A9JNR5	1125	1077	0.456	0.509	A9JNR5_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosb PE=2 SV=1
6	B3VK56	1404	1434	0.564	0.473	B3VK56_HUMAN Nitric oxide synthase OS=Homo sapiens OX=9606 GN=NOS1 PE=2 SV=1
7	F1QML0	1130	1077	0.456	0.510	F1QML0_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosb PE=3 SV=1
8	H0VEY0	1395	1465	0.567	0.466	H0VEY0_CAVPO Nitric oxide synthase 1 OS=Cavia porcellus OX=10141 GN=NOS1 PE=3 SV=2
9	P29473	2237	1205	0.938	0.937	NOS3_BOVIN Nitric oxide synthase 3 OS=Bos taurus OX=9913 GN=NOS3 PE=1 SV=3
10	P29474	2472	1203	1.000	1.000	NOS3_HUMAN Nitric oxide synthase 3 OS=Homo sapiens OX=9606 GN=NOS3 PE=1 SV=4
11	P29475	1404	1434	0.564	0.473	NOS1_HUMAN Nitric oxide synthase 1 OS=Homo sapiens OX=9606 GN=NOS1 PE=1 SV=2
12	P29476	1396	1429	0.557	0.469	NOS1_RAT Nitric oxide synthase 1 OS=Rattus norvegicus OX=10116 GN=Nos1 PE=1 SV=1
13	P29477	1177	1144	0.475	0.500	NOS2_MOUSE Nitric oxide synthase, inducible OS=Mus musculus OX=10090 GN=Nos2 PE=1 SV=1
14	P35228	1176	1153	0.483	0.504	NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo sapiens OX=9606 GN=NOS2 PE=1 SV=2
15	P70313	2236	1202	0.942	0.943	NOS3_MOUSE Nitric oxide synthase 3 OS=Mus musculus OX=10090 GN=Nos3 PE=1 SV=4
16	Q06518	1179	1147	0.477	0.500	NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus OX=10116 GN=Nos2 PE=1 SV=2
17	Q156E2	721	761	0.287	0.453	Q156E2_ONCMY nitric-oxide synthase (NADPH) (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
18	Q27571	1065	1349	0.453	0.404	NOS_DROME Nitric oxide synthase OS=Drosophila melanogaster OX=7227 GN=Nos PE=1 SV=3
19	Q28969	2227	1205	0.939	0.938	NOS3_PIG Nitric oxide synthase 3 OS=Sus scrofa OX=9823 GN=NOS3 PE=1 SV=4
20	Q62600	2242	1202	0.942	0.943	NOS3_RAT Nitric oxide synthase 3 OS=Rattus norvegicus OX=10116 GN=Nos3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19802 DUF6285	6.7e+02	12.5	Domain of unknown function (DUF6285)
2	PF00667 FAD_binding_1	3.5e-79	277.0	FAD binding domain
3	PF00258 Flavodoxin_1	7.2e-49	177.1	Flavodoxin
4	PF00175 NAD_binding_1	1.6e-15	69.1	Oxidoreductase NAD-binding domain
5	PF02898 NO_synthase	7.2e-173	586.2	Nitric oxide synthase, oxygenase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297494

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335153	0.999	Heat shock protein HSP 90-alpha
2	9606.ENSP00000339191	0.999	Caveolin-1
3	9606.ENSP00000451828	0.999	RAC-alpha serine/threonine-protein kinase
4	9606.ENSP00000341940	0.998	Caveolin-3
5	9606.ENSP00000405330	0.998	Estrogen receptor
6	9606.ENSP00000349467	0.997	Calmodulin-1
7	9606.ENSP00000265023	0.990	Kininogen-1
8	9606.ENSP00000272298	0.985	Calmodulin 2 (phosphorylase kinase, delta)
9	9606.ENSP00000450482	0.985	B2 bradykinin receptor
10	9606.ENSP00000478570	0.985	Vascular endothelial growth factor A
11	9606.ENSP00000343925	0.984	Estrogen receptor beta
12	9606.ENSP00000263923	0.983	Vascular endothelial growth factor receptor 2
13	9606.ENSP00000360609	0.979	Heat shock protein HSP 90-beta
14	9606.ENSP00000349960	0.974	Actin, cytoplasmic 1
15	9606.ENSP00000261783	0.973	Arginase-2, mitochondrial
16	9606.ENSP00000361471	0.970	Argininosuccinate synthase
17	9606.ENSP00000307188	0.968	Argininosuccinate lyase
18	9606.ENSP00000437955	0.968	Hypoxia-inducible factor 1-alpha
19	9606.ENSP00000470034	0.967	Nitric oxide synthase-interacting protein
20	9606.ENSP00000349446	0.966	Arginase-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004517	1.000	nitric-oxide synthase activity
GO:0019899	0.818	enzyme binding
GO:0036094	0.609	small molecule binding
GO:0043167	0.513	ion binding
GO:0097159	0.489	organic cyclic compound binding
GO:1901363	0.466	heterocyclic compound binding
GO:0051117	0.349	ATPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008152	0.989	metabolic process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0009987	0.988	cellular process
GO:2001057	0.963	reactive nitrogen species metabolic process
GO:0051716	0.958	cellular response to stimulus
GO:0048518	0.956	positive regulation of biological process
GO:0006809	0.951	nitric oxide biosynthetic process
GO:0032501	0.861	multicellular organismal process
GO:0048522	0.826	positive regulation of cellular process
GO:0019222	0.807	regulation of metabolic process
GO:0071704	0.711	organic substance metabolic process
GO:0007154	0.696	cell communication
GO:0042221	0.667	response to chemical
GO:0006950	0.665	response to stress
GO:0048519	0.653	negative regulation of biological process
GO:0023052	0.628	signaling
GO:0032502	0.623	developmental process
GO:0070887	0.617	cellular response to chemical stimulus
GO:0031323	0.600	regulation of cellular metabolic process
GO:0007165	0.587	signal transduction
GO:0080090	0.585	regulation of primary metabolic process
GO:0060255	0.584	regulation of macromolecule metabolic process
GO:0065008	0.580	regulation of biological quality
GO:0044238	0.550	primary metabolic process
GO:0051171	0.521	regulation of nitrogen compound metabolic process
GO:0048583	0.506	regulation of response to stimulus
GO:1901700	0.502	response to oxygen-containing compound
GO:0065009	0.496	regulation of molecular function
GO:0048523	0.476	negative regulation of cellular process
GO:0048856	0.458	anatomical structure development
GO:0051239	0.457	regulation of multicellular organismal process
GO:0010033	0.452	response to organic substance
GO:0009893	0.451	positive regulation of metabolic process
GO:0009889	0.438	regulation of biosynthetic process
GO:0003013	0.435	circulatory system process
GO:1901564	0.433	organonitrogen compound metabolic process
GO:0010646	0.426	regulation of cell communication
GO:0023051	0.424	regulation of signaling
GO:0009966	0.407	regulation of signal transduction
GO:0031325	0.407	positive regulation of cellular metabolic process
GO:0009605	0.400	response to external stimulus
GO:0051173	0.399	positive regulation of nitrogen compound metabolic process
GO:0031326	0.388	regulation of cellular biosynthetic process
GO:0007275	0.364	multicellular organism development
GO:0010604	0.358	positive regulation of macromolecule metabolic process
GO:0071840	0.338	cellular component organization or biogenesis
GO:0048584	0.332	positive regulation of response to stimulus
GO:0010468	0.324	regulation of gene expression
GO:0019220	0.319	regulation of phosphate metabolic process
GO:0019219	0.316	regulation of nucleobase-containing compound metabolic process
GO:0050790	0.311	regulation of catalytic activity
GO:0016043	0.307	cellular component organization
GO:0042127	0.300	regulation of cell population proliferation
GO:0010941	0.300	regulation of cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0005886	0.978	plasma membrane
GO:0005634	0.948	nucleus
GO:0005829	0.936	cytosol
GO:0031982	0.848	vesicle
GO:0031090	0.629	organelle membrane
GO:0005794	0.539	Golgi apparatus
GO:0070013	0.538	intracellular organelle lumen
GO:0012506	0.530	vesicle membrane
GO:0031981	0.433	nuclear lumen
GO:0043232	0.354	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19897	1.000	H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide
EC:1.14.13.39	1.000	nitric-oxide synthase (NADPH).

[back to server]