StarFunc result for job id P29475

User Input

>input (1434 residues)
MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAP
RPPGQDPAKKATRVSLQGRGENNELLKEIEPVLSLLTSGSRGVKGGAPAKAEMKDMGIQV
DRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPTSGKQSPTKNGSPS
KCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRPEDVRTKGQLF
PLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRC
VGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVW
NSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQ
IPPELVLEVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGV
RDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSAT
ESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHV
WKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCE
IFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQ
EERKSYKVRFNSVSSYSDSQKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAF
GHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANN
SLISNDRSWKRNKFRLTFVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFV
RLHTNGSQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGV
ISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEY
EEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIV
SYRTRDGEGPIHHGVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAP
FRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSRE
PDKPKKYVQDILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAE
DAGVFISRMRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IQG7	0.780	0.781	0.000	1431	0.745	0.746	A0A0R4IQG7.pdb.gz	A0A0R4IQG7_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=nNOS PE=1 SV=1
2	AFDB:A2BIN8	0.400	0.527	0.000	1079	0.389	0.517	A2BIN8.pdb.gz	A2BIN8_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosa PE=3 SV=1
3	AFDB:A9JNR5	0.395	0.522	0.000	1077	0.393	0.523	A9JNR5.pdb.gz	A9JNR5_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosb PE=2 SV=1
4	AFDB:P29475	1.000	1.000	0.000	1434	1.000	1.000	P29475.pdb.gz	NOS1_HUMAN Nitric oxide synthase 1 OS=Homo sapiens OX=9606 GN=NOS1 PE=1 SV=2
5	AFDB:P35228	0.369	0.452	0.000	1153	0.429	0.533	P35228.pdb.gz	NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo sapiens OX=9606 GN=NOS2 PE=1 SV=2
6	AFDB:Q06518	0.360	0.442	0.000	1147	0.419	0.524	Q06518.pdb.gz	NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus OX=10116 GN=Nos2 PE=1 SV=2
7	AFDB:Q6Y5E2	0.698	0.819	0.000	1209	0.480	0.569	Q6Y5E2.pdb.gz	Q6Y5E2_RABIT Nitric oxide synthase OS=Oryctolagus cuniculus OX=9986 PE=2 SV=1
8	AFDB:Q90WQ9	0.388	0.500	0.000	1100	0.393	0.513	Q90WQ9.pdb.gz	Q90WQ9_ONCMY Nitric oxide synthase OS=Oncorhynchus mykiss OX=8022 GN=NOS2 PE=3 SV=1
9	AFDB:Q156E2	0.305	0.565	2.767E-91	761	0.368	0.693	Q156E2.pdb.gz	Q156E2_ONCMY nitric-oxide synthase (NADPH) (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
10	AFDB:C5YJG8	0.373	0.736	8.069E-48	706	0.136	0.276	C5YJG8.pdb.gz	NCPR_SORBI NADPH--cytochrome P450 reductase OS=Sorghum bicolor OX=4558 GN=CPR PE=1 SV=1
11	PDB:6j79A	0.302	0.506	9.133E-45	816	0.144	0.252	6j79A.pdb.gz	Crystal structure of a NADPH-cytochrome P450 oxidoreductase (CYPOR) and heme oxygenase 1 fusion protein implies a conformational change in CYPOR upon NADPH/NADP+binding.
12	PDB:5gxuA	0.317	0.759	5.024E-43	552	0.124	0.322	5gxuA.pdb.gz	Structure of the Arabidopsis thaliana NADPH-cytochrome P450 reductase 2 (ATR2) provides insight into its function
13	PDB:4d3iA	0.247	0.961	4.898E-41	363	0.108	0.427	4d3iA.pdb.gz	Structure-Based Design of Bacterial Nitric Oxide Synthase Inhibitors.
14	PDB:2bf4A	0.357	0.752	6.118E-38	645	0.115	0.256	2bf4A.pdb.gz	A Second Fmn-Binding Site in Yeast Nadph-Cytochrome P450 Reductase Suggests a Mechanism of Electron Transfer by Diflavin Reductases.
15	PDB:7suzA	0.245	0.874	6.374E-33	389	0.096	0.352	7suzA.pdb.gz	Functional and structural insight into the flexibility of cytochrome P450 reductases from Sorghum bicolor and its implications for lignin composition.
16	PDB:3lvbA	0.173	0.749	1.312E-15	311	0.053	0.244	3lvbA.pdb.gz	Biochemical and crystallographic characterization of ferredoxin-NADP(+) reductase from nonphotosynthetic tissues
17	PDB:1gvhA	0.149	0.480	6.432E-9	396	0.040	0.146	1gvhA.pdb.gz	The X-Ray Structure of Ferric Escherichia Coli Flavohemoglobin Reveals an Unexpected Geometry of the Distal Heme Pocket
18	PDB:7xk3F	0.147	0.468	2.762E-8	408	0.033	0.115	7xk3F.pdb.gz	Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.
19	PDB:2m6sA	0.091	0.771	1.126E-7	149	0.026	0.255	2m6sA.pdb.gz	1H, 13C and 15N resonance assignments of the apo and holo states of flavodoxin YqcA from Escherichia coli.
20	PDB:1fdrA	0.136	0.702	1.621E-7	244	0.036	0.209	1fdrA.pdb.gz	The three-dimensional structure of flavodoxin reductase from Escherichia coli at 1.7 A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060XV60	1174	1083	0.393	0.520	A0A060XV60_ONCMY Nitric oxide synthase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00018385001 PE=3 SV=1
2	A0A0R4IQG7	2244	1431	0.746	0.748	A0A0R4IQG7_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=nNOS PE=1 SV=1
3	A2BIN8	1174	1079	0.391	0.519	A2BIN8_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosa PE=3 SV=1
4	A7WK81	1173	1079	0.391	0.519	A7WK81_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=NOS2 PE=2 SV=1
5	A9JNR5	1168	1077	0.392	0.522	A9JNR5_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosb PE=2 SV=1
6	B3VK56	2996	1434	1.000	1.000	B3VK56_HUMAN Nitric oxide synthase OS=Homo sapiens OX=9606 GN=NOS1 PE=2 SV=1
7	F1QML0	1176	1077	0.393	0.524	F1QML0_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosb PE=3 SV=1
8	H0VEY0	2766	1465	0.939	0.919	H0VEY0_CAVPO Nitric oxide synthase 1 OS=Cavia porcellus OX=10141 GN=NOS1 PE=3 SV=2
9	P29473	1401	1205	0.475	0.565	NOS3_BOVIN Nitric oxide synthase 3 OS=Bos taurus OX=9913 GN=NOS3 PE=1 SV=3
10	P29474	1396	1203	0.473	0.564	NOS3_HUMAN Nitric oxide synthase 3 OS=Homo sapiens OX=9606 GN=NOS3 PE=1 SV=4
11	P29475	2996	1434	1.000	1.000	NOS1_HUMAN Nitric oxide synthase 1 OS=Homo sapiens OX=9606 GN=NOS1 PE=1 SV=2
12	P29476	2765	1429	0.936	0.939	NOS1_RAT Nitric oxide synthase 1 OS=Rattus norvegicus OX=10116 GN=Nos1 PE=1 SV=1
13	P29477	1227	1144	0.410	0.514	NOS2_MOUSE Nitric oxide synthase, inducible OS=Mus musculus OX=10090 GN=Nos2 PE=1 SV=1
14	P35228	1256	1153	0.429	0.533	NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo sapiens OX=9606 GN=NOS2 PE=1 SV=2
15	P70313	1420	1202	0.469	0.560	NOS3_MOUSE Nitric oxide synthase 3 OS=Mus musculus OX=10090 GN=Nos3 PE=1 SV=4
16	Q06518	1243	1147	0.414	0.518	NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus OX=10116 GN=Nos2 PE=1 SV=2
17	Q156E2	1055	761	0.365	0.687	Q156E2_ONCMY nitric-oxide synthase (NADPH) (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
18	Q27571	1140	1349	0.395	0.420	NOS_DROME Nitric oxide synthase OS=Drosophila melanogaster OX=7227 GN=Nos PE=1 SV=3
19	Q28969	1381	1205	0.468	0.557	NOS3_PIG Nitric oxide synthase 3 OS=Sus scrofa OX=9823 GN=NOS3 PE=1 SV=4
20	Q62600	1421	1202	0.472	0.563	NOS3_RAT Nitric oxide synthase 3 OS=Rattus norvegicus OX=10116 GN=Nos3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00667 FAD_binding_1	2.1e-83	290.8	FAD binding domain
2	PF00258 Flavodoxin_1	5.3e-51	184.0	Flavodoxin
3	PF00175 NAD_binding_1	1.4e-18	78.8	Oxidoreductase NAD-binding domain
4	PF02898 NO_synthase	6e-180	609.5	Nitric oxide synthase, oxygenase domain
5	PF00595 PDZ	1.3e-12	59.3	PDZ domain
6	PF13180 PDZ_2	12	17.7	PDZ domain
7	PF17820 PDZ_6	1.6e-05	36.0	PDZ domain
8	PF02163 Peptidase_M50	36	15.1	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477999

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355133	0.999	Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
2	9606.ENSP00000382428	0.999	Disks large homolog 4
3	9606.ENSP00000354923	0.997	Dystrophin
4	9606.ENSP00000225688	0.993	Dexamethasone-induced Ras-related protein 1
5	9606.ENSP00000477455	0.993	Glutamate receptor ionotropic, NMDA 2B
6	9606.ENSP00000272298	0.985	Calmodulin 2 (phosphorylase kinase, delta)
7	9606.ENSP00000355533	0.985	Ryanodine receptor 2
8	9606.ENSP00000350310	0.977	Plasma membrane calcium-transporting ATPase 4
9	9606.ENSP00000360608	0.976	Glutamate receptor ionotropic, NMDA 1
10	9606.ENSP00000261783	0.968	Arginase-2, mitochondrial
11	9606.ENSP00000349446	0.965	Arginase-1
12	9606.ENSP00000335153	0.959	Heat shock protein HSP 90-alpha
13	9606.ENSP00000361471	0.959	Argininosuccinate synthase
14	9606.ENSP00000379818	0.957	Glutamate receptor ionotropic, NMDA 2A
15	9606.ENSP00000341940	0.954	Caveolin-3
16	9606.ENSP00000307188	0.948	Argininosuccinate lyase
17	9606.ENSP00000349467	0.948	Calmodulin-1
18	9606.ENSP00000294517	0.944	Antizyme inhibitor 2
19	9606.ENSP00000291295	0.938	Calmodulin 3 (phosphorylase kinase, delta)
20	9606.ENSP00000408695	0.935	Protein kinase C alpha type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004517	0.999	nitric-oxide synthase activity
GO:0043168	0.948	anion binding
GO:0036094	0.940	small molecule binding
GO:0044325	0.935	transmembrane transporter binding
GO:0019899	0.765	enzyme binding
GO:0031406	0.729	carboxylic acid binding
GO:0016597	0.688	amino acid binding
GO:0043169	0.673	cation binding
GO:0034618	0.533	arginine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0051716	0.986	cellular response to stimulus
GO:0008152	0.980	metabolic process
GO:0007154	0.979	cell communication
GO:0023052	0.978	signaling
GO:0006807	0.955	nitrogen compound metabolic process
GO:0042221	0.944	response to chemical
GO:0044237	0.940	cellular metabolic process
GO:0032502	0.922	developmental process
GO:0032501	0.909	multicellular organismal process
GO:0048519	0.889	negative regulation of biological process
GO:0048518	0.840	positive regulation of biological process
GO:0007165	0.840	signal transduction
GO:0003008	0.834	system process
GO:0048856	0.815	anatomical structure development
GO:2001057	0.798	reactive nitrogen species metabolic process
GO:0071704	0.747	organic substance metabolic process
GO:0019222	0.738	regulation of metabolic process
GO:0046209	0.725	nitric oxide metabolic process
GO:0010033	0.716	response to organic substance
GO:0065008	0.702	regulation of biological quality
GO:0044238	0.698	primary metabolic process
GO:0070887	0.694	cellular response to chemical stimulus
GO:1901564	0.674	organonitrogen compound metabolic process
GO:1901700	0.666	response to oxygen-containing compound
GO:0048522	0.664	positive regulation of cellular process
GO:0051239	0.644	regulation of multicellular organismal process
GO:0031323	0.633	regulation of cellular metabolic process
GO:0051171	0.625	regulation of nitrogen compound metabolic process
GO:0006809	0.625	nitric oxide biosynthetic process
GO:0080090	0.621	regulation of primary metabolic process
GO:0006950	0.605	response to stress
GO:0060255	0.569	regulation of macromolecule metabolic process
GO:0035556	0.502	intracellular signal transduction
GO:0048523	0.477	negative regulation of cellular process
GO:0065009	0.453	regulation of molecular function
GO:0009893	0.451	positive regulation of metabolic process
GO:0048583	0.446	regulation of response to stimulus
GO:0010646	0.409	regulation of cell communication
GO:0010604	0.408	positive regulation of macromolecule metabolic process
GO:0051246	0.403	regulation of protein metabolic process
GO:0051049	0.394	regulation of transport
GO:0019220	0.384	regulation of phosphate metabolic process
GO:0031399	0.379	regulation of protein modification process
GO:0051247	0.370	positive regulation of protein metabolic process
GO:0031325	0.346	positive regulation of cellular metabolic process
GO:0003013	0.345	circulatory system process
GO:0071840	0.335	cellular component organization or biogenesis
GO:0019932	0.333	second-messenger-mediated signaling
GO:0071869	0.319	response to catecholamine
GO:0023051	0.318	regulation of signaling
GO:0071310	0.315	cellular response to organic substance
GO:0042325	0.311	regulation of phosphorylation
GO:0071868	0.305	cellular response to monoamine stimulus
GO:0001932	0.304	regulation of protein phosphorylation
GO:0051179	0.300	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005886	0.998	plasma membrane
GO:0005634	0.996	nucleus
GO:0012505	0.994	endomembrane system
GO:0005654	0.991	nucleoplasm
GO:0005829	0.986	cytosol
GO:0005783	0.842	endoplasmic reticulum
GO:0031090	0.785	organelle membrane
GO:0043228	0.769	non-membrane-bounded organelle
GO:0043232	0.744	intracellular non-membrane-bounded organelle
GO:0042383	0.508	sarcolemma
GO:0016529	0.398	sarcoplasmic reticulum
GO:0031982	0.307	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19897	0.999	H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide
EC:1.14.13.39	0.999	nitric-oxide synthase (NADPH).

[back to server]