StarFunc result for job id P29508

User Input

>input (390 residues)
MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFD
QVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYL
DAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAI
YFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKD
LSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLR
TMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTN
EEFHCNHPFLFFIRQNKTNSILFYGRFSSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29508	1.000	1.000	4.811E-83	390	1.000	1.000	P29508.pdb.gz	SPB3_HUMAN Serpin B3 OS=Homo sapiens OX=9606 GN=SERPINB3 PE=1 SV=2
2	PDB:2zv6B	0.918	0.965	3.260E-68	371	0.949	0.997	2zv6B.pdb.gz
3	AFDB:Q6UKZ2	0.915	0.921	3.583E-58	387	0.572	0.576	Q6UKZ2.pdb.gz	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
4	AFDB:A0A0A0MQW3	0.893	0.871	4.099E-57	400	0.585	0.570	A0A0A0MQW3.pdb.gz	A0A0A0MQW3_HUMAN Serpin family B member 13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=1
5	AFDB:A2RSF9	0.939	0.949	1.748E-56	386	0.554	0.560	A2RSF9.pdb.gz	A2RSF9_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 3C OS=Mus musculus OX=10090 GN=Serpinb3c PE=1 SV=1
6	AFDB:O73790	0.912	0.869	1.743E-53	410	0.456	0.434	O73790.pdb.gz	SPB10_CHICK Heterochromatin-associated protein MENT OS=Gallus gallus OX=9031 GN=SERPINB10 PE=1 SV=1
7	AFDB:P30740	0.936	0.963	1.492E-52	379	0.490	0.504	P30740.pdb.gz	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
8	AFDB:Q8VHP7	0.935	0.954	3.362E-52	382	0.474	0.484	Q8VHP7.pdb.gz	ILEUB_MOUSE Leukocyte elastase inhibitor B OS=Mus musculus OX=10090 GN=Serpinb1b PE=1 SV=1
9	AFDB:Q9D154	0.932	0.958	6.364E-52	379	0.487	0.501	Q9D154.pdb.gz	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
10	AFDB:R9TNA6	0.945	0.918	1.012E-51	402	0.428	0.415	R9TNA6.pdb.gz	R9TNA6_CHICK Ovalbumin-related protein X OS=Gallus gallus gallus OX=208526 GN=OVALX PE=1 SV=1
11	AFDB:P01014	0.953	0.958	1.277E-51	388	0.454	0.456	P01014.pdb.gz	OVALY_CHICK Ovalbumin-related protein Y OS=Gallus gallus OX=9031 GN=SERPINB14B PE=1 SV=1
12	PDB:4ga7A	0.902	0.952	7.220E-50	369	0.472	0.499	4ga7A.pdb.gz
13	PDB:2h4rA	0.886	0.930	1.167E-45	371	0.436	0.458	2h4rA.pdb.gz
14	PDB:1xqgA	0.878	0.904	2.837E-44	378	0.346	0.357	1xqgA.pdb.gz
15	PDB:2arqA	0.844	0.911	4.682E-42	360	0.408	0.442	2arqA.pdb.gz	Plasminogen activator inhibitor-2 is highly tolerant to P8 residue substitution--implications for serpin mechanistic model and prediction of nsSNP activities
16	PDB:2ol2A	0.857	0.926	2.156E-40	360	0.308	0.333	2ol2A.pdb.gz
17	PDB:1jmoA	0.875	0.802	4.669E-39	427	0.282	0.258	1jmoA.pdb.gz
18	PDB:1yxaA	0.853	0.893	6.613E-39	372	0.321	0.336	1yxaA.pdb.gz
19	PDB:1hp7A	0.862	0.892	1.115E-38	376	0.318	0.330	1hp7A.pdb.gz	A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops.
20	PDB:4x30A	0.847	0.886	1.115E-38	372	0.313	0.328	4x30A.pdb.gz	Crystal structure of human Thyroxine-binding globulin complexed with thyroine at 1.55 Angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P29508	0.0	808	390	1.000	1.000	SPB3_HUMAN Serpin B3 OS=Homo sapiens OX=9606 GN=SERPINB3 PE=1 SV=2
2	P48594	0.0	704	390	0.918	0.918	SPB4_HUMAN Serpin B4 OS=Homo sapiens OX=9606 GN=SERPINB4 PE=1 SV=2
3	Q9UIV8	3.79e-164	467	391	0.585	0.583	SPB13_HUMAN Serpin B13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=2
4	A0A0A0MQW3	7.14e-163	464	400	0.587	0.573	A0A0A0MQW3_HUMAN Serpin family B member 13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=1
5	Q9D1Q5	4.27e-156	446	387	0.582	0.587	Q9D1Q5_MOUSE Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=1 SV=1
6	Q8BHL1	6.85e-154	441	387	0.574	0.579	Q8BHL1_MOUSE Squamous cell carcinoma antigen 2 related protein 1 OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
7	Q6UKZ2	5.34e-153	439	387	0.572	0.576	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
8	A2RSF9	3.74e-147	424	386	0.554	0.560	A2RSF9_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 3C OS=Mus musculus OX=10090 GN=Serpinb3c PE=1 SV=1
9	Q6UKZ1	3.90e-145	419	386	0.546	0.552	Q6UKZ1_MOUSE Serpinb3c OS=Mus musculus OX=10090 GN=Serpinb3c PE=2 SV=1
10	Q9D1E7	5.72e-144	416	386	0.549	0.554	Q9D1E7_MOUSE Serpin domain-containing protein OS=Mus musculus OX=10090 GN=Serpinb3c PE=2 SV=1
11	P01014	1.01e-118	352	388	0.454	0.456	OVALY_CHICK Ovalbumin-related protein Y OS=Gallus gallus OX=9031 GN=SERPINB14B PE=1 SV=1
12	Q9D154	1.02e-116	346	379	0.485	0.499	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
13	O73790	1.39e-115	344	410	0.456	0.434	SPB10_CHICK Heterochromatin-associated protein MENT OS=Gallus gallus OX=9031 GN=SERPINB10 PE=1 SV=1
14	R9TNA6	5.24e-114	340	402	0.436	0.423	R9TNA6_CHICK Ovalbumin-related protein X OS=Gallus gallus gallus OX=208526 GN=OVALX PE=1 SV=1
15	A0A024QZT4	3.10e-113	337	376	0.451	0.468	A0A024QZT4_HUMAN Testicular tissue protein Li 180 OS=Homo sapiens OX=9606 PE=2 SV=1
16	P50453	3.10e-113	337	376	0.451	0.468	SPB9_HUMAN Serpin B9 OS=Homo sapiens OX=9606 GN=SERPINB9 PE=1 SV=1
17	P48595	5.73e-113	337	397	0.464	0.456	SPB10_HUMAN Serpin B10 OS=Homo sapiens OX=9606 GN=SERPINB10 PE=1 SV=1
18	P30740	8.79e-113	336	379	0.490	0.504	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
19	V9HWH1	8.79e-113	336	379	0.490	0.504	V9HWH1_HUMAN Epididymis luminal protein 57 OS=Homo sapiens OX=9606 GN=HEL57 PE=2 SV=1
20	O08804	1.55e-112	335	377	0.469	0.485	O08804_MOUSE NK13 OS=Mus musculus OX=10090 GN=Serpinb6b PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15432 Sec-ASP3	2.6e+02	13.1	Accessory Sec secretory system ASP3
2	PF00079 Serpin	3.4e-133	456.2	Serpin (serine protease inhibitor)
3	PF03401 TctC	4.5e+02	11.3	Tripartite tricarboxylate transporter family receptor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283752

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343445	0.989	Serpin B4
2	9606.ENSP00000216336	0.883	Cathepsin G
3	9606.ENSP00000357836	0.764	Sorting nexin-27
4	9606.ENSP00000264192	0.744	Cytohesin-interacting protein
5	9606.ENSP00000345344	0.684	Cathepsin L1
6	9606.ENSP00000011653	0.683	T-cell surface glycoprotein CD4
7	9606.ENSP00000344192	0.670	Interleukin-17A
8	9606.ENSP00000222032	0.666	Cornifelin
9	9606.ENSP00000386559	0.664	T-cell surface glycoprotein CD8 alpha chain
10	9606.ENSP00000331209	0.655	Ester hydrolase C11orf54
11	9606.ENSP00000398632	0.653	CD44 antigen
12	9606.ENSP00000412178	0.648	Diacylglycerol kinase zeta
13	9606.ENSP00000412237	0.645	Interleukin-10
14	9606.ENSP00000220616	0.642	Thyroglobulin
15	9606.ENSP00000229135	0.642	Interferon gamma
16	9606.ENSP00000380489	0.642	Myoglobin
17	9606.ENSP00000343428	0.640	N-arachidonyl glycine receptor
18	9606.ENSP00000332049	0.633	T-lymphocyte activation antigen CD86
19	9606.ENSP00000324890	0.630	T-cell-specific surface glycoprotein CD28
20	9606.ENSP00000361359	0.630	Tumor necrosis factor receptor superfamily member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004867	1.000	serine-type endopeptidase inhibitor activity
GO:0002020	0.999	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0045861	0.987	negative regulation of proteolysis
GO:0051336	0.986	regulation of hydrolase activity
GO:0043086	0.986	negative regulation of catalytic activity
GO:0048583	0.982	regulation of response to stimulus
GO:0010466	0.972	negative regulation of peptidase activity
GO:0080134	0.937	regulation of response to stress
GO:0048585	0.925	negative regulation of response to stimulus
GO:0048523	0.911	negative regulation of cellular process
GO:0009987	0.908	cellular process
GO:0050896	0.805	response to stimulus
GO:0048518	0.782	positive regulation of biological process
GO:0048522	0.697	positive regulation of cellular process
GO:0031323	0.687	regulation of cellular metabolic process
GO:0002682	0.652	regulation of immune system process
GO:0010951	0.650	negative regulation of endopeptidase activity
GO:0051239	0.477	regulation of multicellular organismal process
GO:0002831	0.452	regulation of response to biotic stimulus
GO:0010468	0.427	regulation of gene expression
GO:0032101	0.416	regulation of response to external stimulus
GO:0019220	0.403	regulation of phosphate metabolic process
GO:0009893	0.397	positive regulation of metabolic process
GO:0009966	0.396	regulation of signal transduction
GO:0010604	0.374	positive regulation of macromolecule metabolic process
GO:0031399	0.355	regulation of protein modification process
GO:0050776	0.350	regulation of immune response
GO:0042325	0.343	regulation of phosphorylation
GO:0002683	0.340	negative regulation of immune system process
GO:0031347	0.338	regulation of defense response
GO:0032102	0.333	negative regulation of response to external stimulus
GO:0032502	0.331	developmental process
GO:0045859	0.325	regulation of protein kinase activity
GO:0031348	0.304	negative regulation of defense response
GO:0051240	0.300	positive regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0043227	0.998	membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0005615	0.994	extracellular space
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0005829	0.990	cytosol
GO:0005654	0.976	nucleoplasm
GO:0031982	0.963	vesicle
GO:0016020	0.958	membrane
GO:0012505	0.952	endomembrane system
GO:0071944	0.943	cell periphery
GO:0070062	0.898	extracellular exosome
GO:0031410	0.890	cytoplasmic vesicle
GO:0005886	0.876	plasma membrane
GO:0030141	0.830	secretory granule
GO:0005773	0.770	vacuole
GO:0005764	0.764	lysosome
GO:0005775	0.707	vacuolar lumen
GO:0034774	0.697	secretory granule lumen
GO:0005766	0.369	primary lysosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]