StarFunc result for job id P29536

User Input

>input (600 residues)
MSRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQRNQTEKQST
GVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSD
LGKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEE
RAVATKKEEEKKGSDRNTGLSRDKDKKREEMKEVAKKEDDEKVKGERRNTDTRKEGEKMK
RAGGNTDMKKEDEKVKRGTGNTDTKKDDEKVKKNEPLHEKEAKDDSKTKTPEKQTPSGPT
KPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVRFTEALEFNTV
VKLFALANTRADDHVAFAIAIMLKANKTITSLNLDSNHITGKGILAIFRALLQNNTLTEL
RFHNQRHICGGKTEMEIAKLLKENTTLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKRLQ
EQRQAQEAKGEKKDLLEVPKAGAVAKGSPKPSPQPSPKPSPKNSPKKGGAPAAPPPPPPP
LAPPLIMENLKNSLSPATQRKMGDKVLPAQEKNSRDQLLAAIRSSNLKQLKKVEVPKLLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29536	1.000	1.000	1.975E-85	600	1.000	1.000	P29536.pdb.gz	LMOD1_HUMAN Leiomodin-1 OS=Homo sapiens OX=9606 GN=LMOD1 PE=1 SV=3
2	AFDB:A0A0G2K0D3	0.502	0.506	1.639E-71	595	0.820	0.827	A0A0G2K0D3.pdb.gz	LMOD1_RAT Leiomodin-1 OS=Rattus norvegicus OX=10116 GN=Lmod1 PE=1 SV=1
3	PDB:4rwtD	0.272	0.579	1.302E-23	280	0.233	0.500	4rwtD.pdb.gz	Mechanisms of leiomodin 2-mediated regulation of actin filament in muscle cells.
4	PDB:5wfnC	0.276	0.849	5.593E-22	193	0.197	0.611	5wfnC.pdb.gz	Mechanisms of leiomodin 2-mediated regulation of actin filament in muscle cells.
5	AFDB:Q9JHJ0	0.278	0.471	5.008E-19	352	0.137	0.233	Q9JHJ0.pdb.gz	TMOD3_MOUSE Tropomodulin-3 OS=Mus musculus OX=10090 GN=Tmod3 PE=1 SV=1
6	AFDB:G1T676	0.271	0.452	7.086E-19	359	0.138	0.231	G1T676.pdb.gz	G1T676_RABIT Tropomodulin 1 OS=Oryctolagus cuniculus OX=9986 GN=TMOD1 PE=4 SV=1
7	AFDB:F1NY71	0.274	0.457	7.508E-19	359	0.142	0.237	F1NY71.pdb.gz
8	AFDB:P70566	0.277	0.472	4.512E-18	351	0.143	0.245	P70566.pdb.gz	TMOD2_RAT Tropomodulin-2 OS=Rattus norvegicus OX=10116 GN=Tmod2 PE=1 SV=1
9	AFDB:Q9JLH8	0.269	0.465	1.916E-17	345	0.122	0.212	Q9JLH8.pdb.gz	TMOD4_MOUSE Tropomodulin-4 OS=Mus musculus OX=10090 GN=Tmod4 PE=2 SV=1
10	AFDB:Q9PUQ6	0.270	0.469	2.873E-17	343	0.125	0.219	Q9PUQ6.pdb.gz	Q9PUQ6_DANRE Sk-tropomodulin OS=Danio rerio OX=7955 GN=Sk-Tmod PE=1 SV=1
11	AFDB:H9KZU7	0.263	0.284	1.002E-13	555	0.182	0.196	H9KZU7.pdb.gz
12	PDB:1a4yA	0.189	0.243	2.571E-4	460	0.038	0.050	1a4yA.pdb.gz
13	PDB:7pzcA	0.167	0.102	1.299E-3	1010	0.042	0.025	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
14	PDB:6o60C	0.173	0.256	3.473E-3	389	0.040	0.062	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
15	PDB:7lfhA	0.147	0.113	9.840E-3	806	0.038	0.029	7lfhA.pdb.gz
16	PDB:2p1nB	0.141	0.145	1.105E-2	571	0.048	0.051	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
17	PDB:4kxfP	0.170	0.119	1.392E-2	866	0.030	0.021	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
18	AFDB:E3W994	0.094	0.055	1.518E-2	1273	0.155	0.073	E3W994.pdb.gz	E3W994_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=2
19	PDB:6hkwA	0.103	0.193	1.859E-2	306	0.032	0.062	6hkwA.pdb.gz
20	PDB:7sa1B	0.140	0.135	1.970E-2	624	0.038	0.037	7sa1B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K0D3	0.0	859	595	0.820	0.827	LMOD1_RAT Leiomodin-1 OS=Rattus norvegicus OX=10116 GN=Lmod1 PE=1 SV=1
2	P29536	0.0	1204	600	1.000	1.000	LMOD1_HUMAN Leiomodin-1 OS=Homo sapiens OX=9606 GN=LMOD1 PE=1 SV=3
3	Q9BV00	2.35e-129	382	269	0.328	0.732	Q9BV00_HUMAN LMOD1 protein OS=Homo sapiens OX=9606 GN=LMOD1 PE=1 SV=1
4	Q6P5Q4	9.14e-81	266	547	0.263	0.289	LMOD2_HUMAN Leiomodin-2 OS=Homo sapiens OX=9606 GN=LMOD2 PE=1 SV=2
5	E1BTG2	1.19e-78	261	552	0.205	0.223	LMOD2_CHICK Leiomodin-2 OS=Gallus gallus OX=9031 GN=LMOD2 PE=1 SV=2
6	A1A5Q0	9.12e-76	253	549	0.233	0.255	LMOD2_RAT Leiomodin-2 OS=Rattus norvegicus OX=10116 GN=Lmod2 PE=1 SV=1
7	Q3UHZ5	1.52e-74	249	550	0.285	0.311	LMOD2_MOUSE Leiomodin-2 OS=Mus musculus OX=10090 GN=Lmod2 PE=1 SV=1
8	E9QA62	4.13e-56	201	571	0.172	0.180	LMOD3_MOUSE Leiomodin-3 OS=Mus musculus OX=10090 GN=Lmod3 PE=1 SV=1
9	Q0VAK6	7.75e-56	200	560	0.157	0.168	LMOD3_HUMAN Leiomodin-3 OS=Homo sapiens OX=9606 GN=LMOD3 PE=1 SV=1
10	P70567	8.89e-44	162	359	0.140	0.234	TMOD1_RAT Tropomodulin-1 OS=Rattus norvegicus OX=10116 GN=Tmod1 PE=2 SV=1
11	Q9NZR1	2.38e-43	160	351	0.150	0.256	TMOD2_HUMAN Tropomodulin-2 OS=Homo sapiens OX=9606 GN=TMOD2 PE=1 SV=1
12	Q91006	3.27e-43	160	359	0.143	0.240	Q91006_CHICK Tropomodulin OS=Gallus gallus OX=9031 PE=2 SV=1
13	Q9DEA6	8.67e-43	159	345	0.143	0.249	Q9DEA6_CHICK Tropomodulin (Fragment) OS=Gallus gallus OX=9031 GN=E-Tmod PE=1 SV=1
14	P70566	1.35e-42	158	351	0.148	0.254	TMOD2_RAT Tropomodulin-2 OS=Rattus norvegicus OX=10116 GN=Tmod2 PE=1 SV=1
15	P49813	1.41e-42	159	359	0.140	0.234	TMOD1_MOUSE Tropomodulin-1 OS=Mus musculus OX=10090 GN=Tmod1 PE=1 SV=2
16	Q9JKK7	2.00e-42	158	351	0.148	0.254	TMOD2_MOUSE Tropomodulin-2 OS=Mus musculus OX=10090 GN=Tmod2 PE=1 SV=2
17	G1T676	2.07e-41	155	359	0.140	0.234	G1T676_RABIT Tropomodulin 1 OS=Oryctolagus cuniculus OX=9986 GN=TMOD1 PE=4 SV=1
18	P28289	3.47e-40	152	359	0.133	0.223	TMOD1_HUMAN Tropomodulin-1 OS=Homo sapiens OX=9606 GN=TMOD1 PE=1 SV=1
19	Q9JHJ0	6.16e-40	151	352	0.142	0.241	TMOD3_MOUSE Tropomodulin-3 OS=Mus musculus OX=10090 GN=Tmod3 PE=1 SV=1
20	Q9NYL9	1.53e-39	150	352	0.142	0.241	TMOD3_HUMAN Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13516 LRR_6	3.3	19.1	Leucine Rich repeat
2	PF03250 Tropomodulin	5.9e-13	60.4	Tropomodulin
3	PF02205 WH2	0.0042	28.1	WH2 motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356257

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379616	0.932	Myosin-11
2	9606.ENSP00000362063	0.907	Cleavage stimulation factor subunit 2
3	9606.ENSP00000284061	0.901	Diacylglycerol kinase epsilon
4	9606.ENSP00000354826	0.849	Caldesmon
5	9606.ENSP00000386857	0.835	Actin, gamma-enteric smooth muscle
6	9606.ENSP00000353452	0.831	Myosin light chain kinase, smooth muscle
7	9606.ENSP00000402373	0.806	Actin, aortic smooth muscle
8	9606.ENSP00000279022	0.799	Myosin regulatory light polypeptide 9
9	9606.ENSP00000367542	0.790	Tropomyosin beta chain
10	9606.ENSP00000351022	0.786	Tropomyosin alpha-1 chain
11	9606.ENSP00000357516	0.767	Tropomyosin alpha-3 chain
12	9606.ENSP00000332444	0.736	Cleavage stimulation factor subunit 2 tau variant
13	9606.ENSP00000345230	0.718	Tropomyosin alpha-4 chain
14	9606.ENSP00000252456	0.712	Calponin-1
15	9606.ENSP00000360293	0.661	Sorbin and SH3 domain-containing protein 1
16	9606.ENSP00000267257	0.650	Paxillin
17	9606.ENSP00000246117	0.642	Nicalin
18	9606.ENSP00000262585	0.637	DENN domain-containing protein 3
19	9606.ENSP00000240123	0.628	Vinexin
20	9606.ENSP00000273666	0.626	Syntaxin-binding protein 5-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005523	1.000	tropomyosin binding
GO:0003779	0.995	actin binding
GO:0003785	0.832	actin monomer binding
GO:0044877	0.315	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0097435	0.980	supramolecular fiber organization
GO:0065007	0.979	biological regulation
GO:0065008	0.972	regulation of biological quality
GO:0050789	0.965	regulation of biological process
GO:1902905	0.949	positive regulation of supramolecular fiber organization
GO:0051495	0.948	positive regulation of cytoskeleton organization
GO:0110053	0.943	regulation of actin filament organization
GO:0044087	0.932	regulation of cellular component biogenesis
GO:0008064	0.908	regulation of actin polymerization or depolymerization
GO:0030029	0.902	actin filament-based process
GO:0031334	0.901	positive regulation of protein-containing complex assembly
GO:0007015	0.886	actin filament organization
GO:0032271	0.825	regulation of protein polymerization
GO:0030833	0.797	regulation of actin filament polymerization
GO:0032273	0.777	positive regulation of protein polymerization
GO:0045010	0.715	actin nucleation
GO:0030838	0.672	positive regulation of actin filament polymerization
GO:0032501	0.337	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030016	0.998	myofibril
GO:0005829	0.992	cytosol
GO:0016020	0.989	membrane
GO:0005856	0.906	cytoskeleton
GO:0015629	0.871	actin cytoskeleton
GO:0043227	0.600	membrane-bounded organelle
GO:0030017	0.565	sarcomere
GO:0099513	0.307	polymeric cytoskeletal fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]