StarFunc result for job id P29558

User Input

>input (406 residues)
MGKVWKQQMYPQYATYYYPQYLQAKQSLVPAHPMAPPSPSTTSSNNNSSSSSNSGWDQLS
KTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAV
SALKASGVQAQMAKQQEQDPTNLYISNLPLSMDEQELENMLKPFGQVISTRILRDSSGTS
RGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQKKRQNPNKYIPN
GRPWHREGEVRLAGMTLTYDPTTAAIQNGFYPSPYSIATNRMITQTSITPYIASPVSAYQ
VQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLGSTGTYMPATS
AMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29558	1.000	1.000	1.946E-69	406	1.000	1.000	P29558.pdb.gz	RBMS1_HUMAN RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens OX=9606 GN=RBMS1 PE=1 SV=3
2	AFDB:Q6XE24	0.507	0.476	1.229E-52	437	0.773	0.719	Q6XE24.pdb.gz	RBMS3_HUMAN RNA-binding motif, single-stranded-interacting protein 3 OS=Homo sapiens OX=9606 GN=RBMS3 PE=1 SV=1
3	AFDB:Q57WD0	0.194	0.136	5.805E-18	593	0.204	0.140	Q57WD0.pdb.gz	Q57WD0_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.400 PE=4 SV=1
4	AFDB:Q15427	0.203	0.195	8.873E-17	424	0.195	0.186	Q15427.pdb.gz	SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens OX=9606 GN=SF3B4 PE=1 SV=1
5	AFDB:Q8W034	0.183	0.181	6.492E-14	411	0.135	0.134	Q8W034.pdb.gz	RNP1_ARATH Heterogeneous nuclear ribonucleoprotein 1 OS=Arabidopsis thaliana OX=3702 GN=RNP1 PE=1 SV=1
6	AFDB:F4JYK6	0.181	0.163	3.169E-13	453	0.182	0.163	F4JYK6.pdb.gz	F4JYK6_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=MNJ7.21 PE=1 SV=1
7	AFDB:A0A0S2Z4Z0	0.209	0.145	8.204E-13	669	0.180	0.109	A0A0S2Z4Z0.pdb.gz	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
8	AFDB:O43719	0.184	0.102	4.267E-12	755	0.155	0.083	O43719.pdb.gz	HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1
9	PDB:6y53o	0.182	0.444	6.086E-12	160	0.108	0.275	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
10	PDB:7oqcF	0.179	0.267	6.909E-12	267	0.094	0.142	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
11	AFDB:A2BIC5	0.204	0.149	2.860E-11	600	0.160	0.108	A2BIC5.pdb.gz
12	AFDB:A0AV96	0.203	0.150	4.184E-11	593	0.175	0.120	A0AV96.pdb.gz	RBM47_HUMAN RNA-binding protein 47 OS=Homo sapiens OX=9606 GN=RBM47 PE=1 SV=2
13	PDB:5lsbA	0.187	0.392	4.838E-10	176	0.086	0.199	5lsbA.pdb.gz
14	PDB:6y5qq	0.167	0.358	1.103E-9	178	0.079	0.180	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:5vsuA	0.187	0.194	1.720E-9	387	0.071	0.075	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
16	PDB:6r5kH	0.206	0.212	1.228E-8	394	0.145	0.150	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
17	PDB:7evoD	0.173	0.345	1.309E-8	200	0.081	0.165	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
18	PDB:6gd1A	0.186	0.387	5.879E-7	190	0.071	0.153	6gd1A.pdb.gz
19	PDB:6ff7X	0.164	0.365	1.341E-6	171	0.076	0.181	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:6c0fo	0.184	0.540	1.622E-6	133	0.057	0.173	6c0fo.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7ETU5	0.0	760	370	0.911	1.000	E7ETU5_HUMAN RNA binding motif single stranded interacting protein 1 OS=Homo sapiens OX=9606 GN=RBMS1 PE=1 SV=1
2	F1QGV3	0.0	563	415	0.741	0.725	F1QGV3_DANRE RNA-binding motif, single stranded-interacting protein OS=Danio rerio OX=7955 GN=zgc:153698 PE=4 SV=1
3	P29558	0.0	840	406	1.000	1.000	RBMS1_HUMAN RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens OX=9606 GN=RBMS1 PE=1 SV=3
4	Q08C34	0.0	545	381	0.675	0.719	Q08C34_DANRE RNA binding motif, single stranded interacting protein OS=Danio rerio OX=7955 GN=zgc:153698 PE=2 SV=1
5	Q15434	0.0	523	407	0.648	0.646	RBMS2_HUMAN RNA-binding motif, single-stranded-interacting protein 2 OS=Homo sapiens OX=9606 GN=RBMS2 PE=1 SV=1
6	Q6XE24	0.0	556	437	0.751	0.698	RBMS3_HUMAN RNA-binding motif, single-stranded-interacting protein 3 OS=Homo sapiens OX=9606 GN=RBMS3 PE=1 SV=1
7	Q8BWL5	0.0	522	431	0.714	0.673	RBMS3_MOUSE RNA-binding motif, single-stranded-interacting protein 3 OS=Mus musculus OX=10090 GN=Rbms3 PE=2 SV=2
8	Q8MSV2	5.71e-76	248	590	0.320	0.220	SHEP_DROME Protein alan shepard OS=Drosophila melanogaster OX=7227 GN=shep PE=1 SV=2
9	D5MCQ2	5.69e-63	209	380	0.283	0.303	D5MCQ2_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
10	D5MCQ1	1.15e-62	207	354	0.266	0.305	D5MCQ1_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
11	Q7JMB8	1.22e-62	207	357	0.266	0.303	Q7JMB8_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
12	D5MCQ6	2.56e-62	209	438	0.283	0.263	D5MCQ6_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
13	D5MCQ3	3.36e-62	207	406	0.281	0.281	D5MCQ3_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
14	Q21900	3.44e-62	207	409	0.281	0.279	Q21900_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=2
15	D5MCQ7	5.62e-62	207	412	0.266	0.262	D5MCQ7_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
16	D5MCQ4	5.66e-62	204	316	0.261	0.335	D5MCQ4_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
17	D5MCR4	8.01e-62	207	424	0.266	0.255	D5MCR4_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
18	D5MCQ5	1.25e-61	207	464	0.281	0.246	D5MCQ5_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
19	D5MCR3	2.37e-61	207	476	0.266	0.227	D5MCR3_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1
20	D5MCR5	2.65e-61	204	371	0.261	0.286	D5MCR5_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sup-26 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07576 BRAP2	12	17.5	BRCA1-associated protein 2
2	PF09751 Es2	65	14.7	Nuclear protein Es2
3	PF00076 RRM_1	1.1e-28	110.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16367 RRM_7	34	16.0	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294904

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313875	0.744	Membrane cofactor protein
2	9606.ENSP00000300026	0.720	Peptidyl-prolyl cis-trans isomerase B
3	9606.ENSP00000367038	0.650	Ribosome-binding protein 1
4	9606.ENSP00000360569	0.648	Non-specific lipid-transfer protein
5	9606.ENSP00000244520	0.644	U1 small nuclear ribonucleoprotein C
6	9606.ENSP00000348056	0.644	SUMO-conjugating enzyme UBC9
7	9606.ENSP00000230085	0.632	Sorting nexin-3
8	9606.ENSP00000290524	0.632	DNA-binding protein RFX5
9	9606.ENSP00000225174	0.623	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
10	9606.ENSP00000343867	0.623	Ribosome-recycling factor, mitochondrial
11	9606.ENSP00000438527	0.623	Zinc finger CCCH domain-containing protein 11A
12	9606.ENSP00000245907	0.622	Complement C3
13	9606.ENSP00000254878	0.621	2-iminobutanoate/2-iminopropanoate deaminase
14	9606.ENSP00000258105	0.619	Mitochondrial ribosomal protein L53
15	9606.ENSP00000356918	0.619	Syntaxin-7
16	9606.ENSP00000218224	0.618	Polyglutamine-binding protein 1
17	9606.ENSP00000369545	0.618	SOSS complex subunit B1
18	9606.ENSP00000337632	0.617	SAP domain-containing ribonucleoprotein
19	9606.ENSP00000356030	0.617	Complement decay-accelerating factor
20	9606.ENSP00000247001	0.616	SURP and G-patch domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.913	mRNA binding
GO:0003730	0.413	mRNA 3'-UTR binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.977	cellular process
GO:0065007	0.966	biological regulation
GO:0050789	0.964	regulation of biological process
GO:0071704	0.932	organic substance metabolic process
GO:0044238	0.925	primary metabolic process
GO:0006807	0.907	nitrogen compound metabolic process
GO:0044237	0.893	cellular metabolic process
GO:0050794	0.838	regulation of cellular process
GO:0043170	0.836	macromolecule metabolic process
GO:1901360	0.834	organic cyclic compound metabolic process
GO:0034641	0.834	cellular nitrogen compound metabolic process
GO:0006725	0.816	cellular aromatic compound metabolic process
GO:0006139	0.812	nucleobase-containing compound metabolic process
GO:0090304	0.804	nucleic acid metabolic process
GO:0016070	0.778	RNA metabolic process
GO:0010467	0.766	gene expression
GO:0006396	0.695	RNA processing
GO:0048518	0.534	positive regulation of biological process
GO:0019222	0.514	regulation of metabolic process
GO:0060255	0.457	regulation of macromolecule metabolic process
GO:0010468	0.345	regulation of gene expression
GO:0010604	0.328	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0070013	0.465	intracellular organelle lumen
GO:0043231	0.406	intracellular membrane-bounded organelle
GO:0032991	0.329	protein-containing complex
GO:0005634	0.323	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]