StarFunc result for job id P29590

User Input

>input (882 residues)
MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQC
QAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYR
QIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDG
TRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEEL
DAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEA
VDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLR
QEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCS
QTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLP
NSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENL
ADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQ
HFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPG
ASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFAS
LQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPA
FNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29590	1.000	1.000	0.000	882	1.000	1.000	P29590.pdb.gz	PML_HUMAN Protein PML OS=Homo sapiens OX=9606 GN=PML PE=1 SV=3
2	AFDB:F1M589	0.451	0.449	6.038E-97	886	0.681	0.678	F1M589.pdb.gz	F1M589_RAT PML nuclear body scaffold OS=Rattus norvegicus OX=10116 GN=Pml PE=1 SV=3
3	AFDB:Q60953	0.416	0.415	8.739E-96	885	0.672	0.670	Q60953.pdb.gz	PML_MOUSE Protein PML OS=Mus musculus OX=10090 GN=Pml PE=1 SV=3
4	AFDB:A0A0D9RNP7	0.385	0.412	8.623E-69	819	0.616	0.663	A0A0D9RNP7.pdb.gz	A0A0D9RNP7_CHLSB PML nuclear body scaffold OS=Chlorocebus sabaeus OX=60711 GN=PML PE=4 SV=1
5	AFDB:Q15156	0.347	0.379	5.031E-56	797	0.451	0.499	Q15156.pdb.gz	Q15156_HUMAN PML-RAR protein OS=Homo sapiens OX=9606 GN=PML-RAR PE=1 SV=1
6	AFDB:Q9U3Y7	0.275	0.223	3.001E-12	1133	0.112	0.087	Q9U3Y7.pdb.gz	Q9U3Y7_DROME Bonus OS=Drosophila melanogaster OX=7227 GN=bon PE=2 SV=1
7	AFDB:Q99PJ2	0.200	0.304	7.412E-11	551	0.094	0.151	Q99PJ2.pdb.gz	TRIM8_MOUSE E3 ubiquitin-protein ligase TRIM8 OS=Mus musculus OX=10090 GN=Trim8 PE=1 SV=3
8	AFDB:B7ZVP9	0.213	0.313	1.137E-10	564	0.085	0.133	B7ZVP9.pdb.gz	B7ZVP9_DANRE Similar to tripartite motif-containing 8 OS=Danio rerio OX=7955 GN=LOC797338 PE=2 SV=1
9	AFDB:E7FCI6	0.215	0.316	4.324E-10	567	0.095	0.148	E7FCI6.pdb.gz	E7FCI6_DANRE Probable E3 ubiquitin-protein ligase TRIM8 isoform X1 OS=Danio rerio OX=7955 GN=trim8a PE=4 SV=2
10	AFDB:G3X8Y1	0.185	0.278	2.637E-7	545	0.091	0.147	G3X8Y1.pdb.gz	G3X8Y1_MOUSE Tripartite motif-containing 55 OS=Mus musculus OX=10090 GN=Trim55 PE=1 SV=1
11	PDB:7z36B	0.200	0.353	4.826E-5	446	0.048	0.094	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
12	PDB:8d0kF	0.140	0.135	9.668E-5	915	0.049	0.047	8d0kF.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
13	PDB:2oyqA	0.146	0.151	6.621E-4	848	0.035	0.037	2oyqA.pdb.gz	Caught bending the a-rule: crystal structures of translesion DNA synthesis with a non-natural nucleotide.
14	PDB:3k5nA	0.123	0.141	6.621E-4	759	0.037	0.043	3k5nA.pdb.gz	Structural insight into translesion synthesis by DNA Pol II.
15	PDB:3k57A	0.130	0.144	2.264E-3	782	0.036	0.041	3k57A.pdb.gz	Structural insight into translesion synthesis by DNA Pol II
16	PDB:5c0wK	0.115	0.161	2.264E-3	576	0.036	0.056	5c0wK.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
17	PDB:5c0xK	0.110	0.230	2.957E-3	350	0.031	0.077	5c0xK.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
18	PDB:4i9qB	0.150	0.151	3.119E-3	873	0.026	0.026	4i9qB.pdb.gz	A Remote Palm Domain Residue of RB69 DNA Polymerase Is Critical for Enzyme Activity and Influences the Conformation of the Active Site.
19	PDB:3cfoA	0.146	0.142	3.662E-3	906	0.035	0.034	3cfoA.pdb.gz	Structure of the replication complex of a POL Alpha family DNA Polymerase
20	PDB:3u3yB	0.151	0.534	4.535E-3	220	0.039	0.155	3u3yB.pdb.gz	Defects in DNA degradation revealed in crystal structures of TREX1 exonuclease mutations linked to autoimmune disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0D9RNP7	0.0	1119	819	0.618	0.665	A0A0D9RNP7_CHLSB PML nuclear body scaffold OS=Chlorocebus sabaeus OX=60711 GN=PML PE=4 SV=1
2	A0A8I6AC37	0.0	1175	925	0.688	0.656	A0A8I6AC37_RAT PML nuclear body scaffold OS=Rattus norvegicus OX=10116 GN=Pml PE=1 SV=1
3	A0A8I6ACX4	0.0	1182	879	0.676	0.678	A0A8I6ACX4_RAT PML nuclear body scaffold OS=Rattus norvegicus OX=10116 GN=Pml PE=1 SV=1
4	A0A8I6GKM3	0.0	1198	879	0.688	0.691	A0A8I6GKM3_RAT PML nuclear body scaffold OS=Rattus norvegicus OX=10116 GN=Pml PE=1 SV=1
5	F1M589	0.0	1196	886	0.688	0.685	F1M589_RAT PML nuclear body scaffold OS=Rattus norvegicus OX=10116 GN=Pml PE=1 SV=3
6	P29590	0.0	1793	882	1.000	1.000	PML_HUMAN Protein PML OS=Homo sapiens OX=9606 GN=PML PE=1 SV=3
7	Q15156	0.0	798	797	0.449	0.497	Q15156_HUMAN PML-RAR protein OS=Homo sapiens OX=9606 GN=PML-RAR PE=1 SV=1
8	Q60953	0.0	1147	885	0.688	0.686	PML_MOUSE Protein PML OS=Mus musculus OX=10090 GN=Pml PE=1 SV=3
9	Q8BSJ6	0.0	702	543	0.424	0.689	Q8BSJ6_MOUSE PML-like coiled-coil domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Pml PE=1 SV=1
10	Q6E2N3	1.95e-13	77.0	1163	0.084	0.064	TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio OX=7955 GN=trim33 PE=2 SV=1
11	O15164	1.30e-12	74.3	1050	0.080	0.068	TIF1A_HUMAN Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24 PE=1 SV=3
12	Q64127	4.82e-12	72.4	1051	0.078	0.066	TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus OX=10090 GN=Trim24 PE=1 SV=1
13	A0A8I6AI80	6.27e-12	72.0	1050	0.078	0.066	A0A8I6AI80_RAT Tripartite motif-containing 24 OS=Rattus norvegicus OX=10116 GN=Trim24 PE=4 SV=1
14	Q99PP7	3.83e-11	69.7	1142	0.073	0.056	TRI33_MOUSE E3 ubiquitin-protein ligase TRIM33 OS=Mus musculus OX=10090 GN=Trim33 PE=1 SV=2
15	Q6PFY8	1.44e-10	67.4	580	0.101	0.153	TRI45_MOUSE E3 ubiquitin-protein ligase TRIM45 OS=Mus musculus OX=10090 GN=Trim45 PE=2 SV=2
16	Q9UPN9	1.78e-10	67.4	1127	0.071	0.056	TRI33_HUMAN E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33 PE=1 SV=3
17	Q9H8W5	2.02e-10	66.6	580	0.094	0.143	TRI45_HUMAN E3 ubiquitin-protein ligase TRIM45 OS=Homo sapiens OX=9606 GN=TRIM45 PE=1 SV=2
18	Q80VI1	1.37e-09	64.3	734	0.096	0.116	TRI56_MOUSE E3 ubiquitin-protein ligase TRIM56 OS=Mus musculus OX=10090 GN=Trim56 PE=1 SV=1
19	Q9W378	1.48e-09	64.3	1189	0.080	0.060	Q9W378_DROME FI01101p OS=Drosophila melanogaster OX=7227 GN=mei-P26 PE=2 SV=1
20	Q62318	1.60e-09	64.3	834	0.075	0.079	TIF1B_MOUSE Transcription intermediary factor 1-beta OS=Mus musculus OX=10090 GN=Trim28 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12126 DUF3583	1.7e-179	607.9	Protein of unknown function (DUF3583)
2	PF15602 Imm71	30	16.1	Immunity protein 71
3	PF03938 OmpH	3.6e+02	12.8	Outer membrane protein (OmpH-like)
4	PF14447 Prok-RING_4	17	16.7	Prokaryotic RING finger family 4
5	PF00643 zf-B_box	0.00018	32.9	B-box zinc finger
6	PF13920 zf-C3HC4_3	0.27	22.4	Zinc finger, C3HC4 type (RING finger)
7	PF14634 zf-RING_5	7	18.0	zinc-RING finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268058

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363668	0.999	Death domain-associated protein 6
2	9606.ENSP00000376077	0.999	Small ubiquitin-related modifier 1
3	9606.ENSP00000269305	0.996	Cellular tumor antigen p53
4	9606.ENSP00000343023	0.996	Nuclear autoantigen Sp-100
5	9606.ENSP00000254066	0.995	Retinoic acid receptor alpha
6	9606.ENSP00000258149	0.995	E3 ubiquitin-protein ligase Mdm2
7	9606.ENSP00000348056	0.994	SUMO-conjugating enzyme UBC9
8	9606.ENSP00000362649	0.986	Histone deacetylase 1
9	9606.ENSP00000405965	0.986	Small ubiquitin-related modifier 2
10	9606.ENSP00000430432	0.985	Histone deacetylase 2
11	9606.ENSP00000262367	0.981	CREB-binding protein
12	9606.ENSP00000212015	0.980	NAD-dependent protein deacetylase sirtuin-1
13	9606.ENSP00000287727	0.975	Zinc finger FYVE domain-containing protein 9
14	9606.ENSP00000409666	0.975	Small ubiquitin-like modifier 3
15	9606.ENSP00000479618	0.973	Myc proto-oncogene protein
16	9606.ENSP00000080059	0.967	Histone deacetylase 7
17	9606.ENSP00000384018	0.967	Nuclear receptor corepressor 2
18	9606.ENSP00000451828	0.964	RAC-alpha serine/threonine-protein kinase
19	9606.ENSP00000268712	0.962	Nuclear receptor corepressor 1
20	9606.ENSP00000368880	0.961	Forkhead box protein O1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.988	transcription regulator activity
GO:0003824	0.982	catalytic activity
GO:0003712	0.981	transcription coregulator activity
GO:0140096	0.970	catalytic activity, acting on a protein
GO:0003713	0.970	transcription coactivator activity
GO:0016740	0.955	transferase activity
GO:0019899	0.946	enzyme binding
GO:0019787	0.859	ubiquitin-like protein transferase activity
GO:0042802	0.841	identical protein binding
GO:0044389	0.708	ubiquitin-like protein ligase binding
GO:0031625	0.674	ubiquitin protein ligase binding
GO:0043167	0.598	ion binding
GO:0008270	0.559	zinc ion binding
GO:0140030	0.552	modification-dependent protein binding
GO:0032182	0.541	ubiquitin-like protein binding
GO:0019789	0.510	SUMO transferase activity
GO:0140037	0.357	sumo-dependent protein binding
GO:0032183	0.329	SUMO binding
GO:0050897	0.302	cobalt ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050789	0.980	regulation of biological process
GO:0050794	0.972	regulation of cellular process
GO:0016043	0.972	cellular component organization
GO:0006996	0.957	organelle organization
GO:0019222	0.955	regulation of metabolic process
GO:0060255	0.942	regulation of macromolecule metabolic process
GO:0006997	0.932	nucleus organization
GO:0048519	0.922	negative regulation of biological process
GO:0048523	0.911	negative regulation of cellular process
GO:0031323	0.880	regulation of cellular metabolic process
GO:0048522	0.877	positive regulation of cellular process
GO:0050896	0.875	response to stimulus
GO:0008152	0.872	metabolic process
GO:0080090	0.866	regulation of primary metabolic process
GO:0051171	0.865	regulation of nitrogen compound metabolic process
GO:0010556	0.861	regulation of macromolecule biosynthetic process
GO:0019219	0.861	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.858	regulation of gene expression
GO:0031326	0.858	regulation of cellular biosynthetic process
GO:0071704	0.855	organic substance metabolic process
GO:0043170	0.829	macromolecule metabolic process
GO:0009893	0.822	positive regulation of metabolic process
GO:2001141	0.820	regulation of RNA biosynthetic process
GO:0044238	0.813	primary metabolic process
GO:0048583	0.810	regulation of response to stimulus
GO:0006807	0.791	nitrogen compound metabolic process
GO:0009966	0.791	regulation of signal transduction
GO:0010604	0.782	positive regulation of macromolecule metabolic process
GO:0006355	0.779	regulation of DNA-templated transcription
GO:0051173	0.715	positive regulation of nitrogen compound metabolic process
GO:0010605	0.707	negative regulation of macromolecule metabolic process
GO:0031325	0.698	positive regulation of cellular metabolic process
GO:0051716	0.694	cellular response to stimulus
GO:0051172	0.688	negative regulation of nitrogen compound metabolic process
GO:0031324	0.688	negative regulation of cellular metabolic process
GO:1901564	0.659	organonitrogen compound metabolic process
GO:0006950	0.655	response to stress
GO:0045935	0.649	positive regulation of nucleobase-containing compound metabolic process
GO:0051246	0.645	regulation of protein metabolic process
GO:0019538	0.629	protein metabolic process
GO:0043412	0.623	macromolecule modification
GO:0065009	0.607	regulation of molecular function
GO:0044237	0.605	cellular metabolic process
GO:0036211	0.589	protein modification process
GO:0023052	0.587	signaling
GO:0007165	0.576	signal transduction
GO:0010558	0.530	negative regulation of macromolecule biosynthetic process
GO:0031327	0.529	negative regulation of cellular biosynthetic process
GO:0045934	0.517	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.462	negative regulation of RNA metabolic process
GO:0048584	0.460	positive regulation of response to stimulus
GO:0051247	0.446	positive regulation of protein metabolic process
GO:0009967	0.409	positive regulation of signal transduction
GO:0010557	0.374	positive regulation of macromolecule biosynthetic process
GO:0033554	0.356	cellular response to stress
GO:0051128	0.343	regulation of cellular component organization
GO:1902679	0.338	negative regulation of RNA biosynthetic process
GO:0031328	0.335	positive regulation of cellular biosynthetic process
GO:0042981	0.332	regulation of apoptotic process
GO:0051239	0.308	regulation of multicellular organismal process
GO:0051179	0.307	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0012505	0.996	endomembrane system
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0016020	0.978	membrane
GO:0005829	0.977	cytosol
GO:0005694	0.931	chromosome
GO:0032991	0.910	protein-containing complex
GO:0016604	0.779	nuclear body
GO:0031967	0.743	organelle envelope
GO:0031090	0.591	organelle membrane
GO:0016605	0.583	PML body
GO:0034399	0.472	nuclear periphery
GO:0005635	0.448	nuclear envelope
GO:0098687	0.407	chromosomal region
GO:0031965	0.385	nuclear membrane
GO:0140513	0.351	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.955	Transferases.

[back to server]