StarFunc result for job id P29597

User Input

>input (1187 residues)
MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREP
AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFK
NESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRR
FLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHK
AVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRA
GDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETAS
LMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLAS
ALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLA
PECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQ
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKI
RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHII
KYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYI
HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYY
ASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKC
PCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZD03	0.667	0.668	0.000	1186	0.795	0.796	D3ZD03.pdb.gz	D3ZD03_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tyk2 PE=1 SV=1
2	AFDB:O12990	0.853	0.877	0.000	1153	0.445	0.458	O12990.pdb.gz	JAK1_DANRE Tyrosine-protein kinase JAK1 OS=Danio rerio OX=7955 GN=jak1 PE=1 SV=1
3	AFDB:P23458	0.624	0.641	0.000	1154	0.447	0.459	P23458.pdb.gz	JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens OX=9606 GN=JAK1 PE=1 SV=2
4	AFDB:P29597	1.000	1.000	0.000	1187	1.000	1.000	P29597.pdb.gz	TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2 OS=Homo sapiens OX=9606 GN=TYK2 PE=1 SV=3
5	AFDB:S5R2L7	0.878	0.886	0.000	1176	0.519	0.524	S5R2L7.pdb.gz	S5R2L7_SALSA Tyrosine-protein kinase OS=Salmo salar OX=8030 PE=2 SV=1
6	AFDB:G1TCI4	0.821	0.859	4.149E-100	1132	0.376	0.394	G1TCI4.pdb.gz	G1TCI4_RABIT Tyrosine-protein kinase OS=Oryctolagus cuniculus OX=9986 GN=JAK2 PE=3 SV=2
7	AFDB:F1QWX8	0.837	0.905	1.144E-98	1095	0.382	0.414	F1QWX8.pdb.gz	F1QWX8_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak4 PE=3 SV=1
8	AFDB:Q62137	0.818	0.880	3.057E-93	1100	0.384	0.415	Q62137.pdb.gz	JAK3_MOUSE Tyrosine-protein kinase JAK3 OS=Mus musculus OX=10090 GN=Jak3 PE=1 SV=2
9	AFDB:B0V237	0.584	0.627	1.328E-91	1103	0.358	0.385	B0V237.pdb.gz	B0V237_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak3 PE=3 SV=1
10	AFDB:P52333	0.584	0.616	2.123E-90	1124	0.378	0.399	P52333.pdb.gz	JAK3_HUMAN Tyrosine-protein kinase JAK3 OS=Homo sapiens OX=9606 GN=JAK3 PE=1 SV=2
11	PDB:4fl2A	0.206	0.423	2.689E-19	555	0.126	0.268	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
12	PDB:4k2rA	0.196	0.405	2.647E-17	551	0.119	0.256	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
13	PDB:1k9aB	0.200	0.523	1.359E-16	441	0.082	0.220	1k9aB.pdb.gz
14	PDB:2h8hA	0.205	0.520	5.075E-16	445	0.084	0.225	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:8dksA	0.188	0.714	1.132E-13	283	0.062	0.261	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:6pjxA	0.210	0.435	3.688E-13	543	0.071	0.155	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
17	PDB:4zhxA	0.198	0.544	5.552E-13	409	0.067	0.196	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
18	PDB:4rerA	0.197	0.485	1.098E-12	459	0.070	0.181	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:3nynA	0.203	0.421	2.170E-12	554	0.066	0.141	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
20	PDB:4yc3A	0.179	0.638	2.170E-12	295	0.056	0.224	4yc3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZU24	984	1140	0.433	0.451	A0A8I5ZU24_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=1 SV=1
2	A0A8I6AJU1	948	1120	0.416	0.441	A0A8I6AJU1_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=1 SV=1
3	A0A8I6AM23	1013	1153	0.444	0.457	A0A8I6AM23_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=1 SV=1
4	B0V237	712	1103	0.365	0.393	B0V237_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak3 PE=3 SV=1
5	D3ZD03	1906	1186	0.794	0.794	D3ZD03_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tyk2 PE=1 SV=1
6	F1QWX8	748	1095	0.391	0.424	F1QWX8_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak4 PE=3 SV=1
7	G1TCI4	761	1132	0.381	0.399	G1TCI4_RABIT Tyrosine-protein kinase OS=Oryctolagus cuniculus OX=9986 GN=JAK2 PE=3 SV=2
8	G3V9W2	1013	1153	0.444	0.457	G3V9W2_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Jak1 PE=3 SV=1
9	K7GSE8	682	1103	0.382	0.411	K7GSE8_PIG Tyrosine-protein kinase OS=Sus scrofa OX=9823 GN=JAK3 PE=3 SV=1
10	O12990	990	1153	0.451	0.464	JAK1_DANRE Tyrosine-protein kinase JAK1 OS=Danio rerio OX=7955 GN=jak1 PE=1 SV=1
11	O35803	720	866	0.329	0.452	O35803_RAT Tyrosine-protein kinase (Fragment) OS=Rattus norvegicus OX=10116 GN=Jak1 PE=2 SV=1
12	O60674	759	1132	0.380	0.398	JAK2_HUMAN Tyrosine-protein kinase JAK2 OS=Homo sapiens OX=9606 GN=JAK2 PE=1 SV=2
13	O93596	745	1095	0.390	0.423	O93596_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=jak4 PE=2 SV=1
14	P23458	1014	1154	0.446	0.458	JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens OX=9606 GN=JAK1 PE=1 SV=2
15	P29597	2455	1187	1.000	1.000	TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2 OS=Homo sapiens OX=9606 GN=TYK2 PE=1 SV=3
16	P52332	1013	1153	0.446	0.459	JAK1_MOUSE Tyrosine-protein kinase JAK1 OS=Mus musculus OX=10090 GN=Jak1 PE=1 SV=1
17	P52333	684	1124	0.390	0.412	JAK3_HUMAN Tyrosine-protein kinase JAK3 OS=Homo sapiens OX=9606 GN=JAK3 PE=1 SV=2
18	Q62120	764	1132	0.381	0.399	JAK2_MOUSE Tyrosine-protein kinase JAK2 OS=Mus musculus OX=10090 GN=Jak2 PE=1 SV=3
19	Q62137	671	1100	0.377	0.407	JAK3_MOUSE Tyrosine-protein kinase JAK3 OS=Mus musculus OX=10090 GN=Jak3 PE=1 SV=2
20	Q62689	765	1132	0.380	0.398	JAK2_RAT Tyrosine-protein kinase JAK2 OS=Rattus norvegicus OX=10116 GN=Jak2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	4.4e+02	11.4	ABC1 atypical kinase-like domain
2	PF01636 APH	1e+02	14.2	Phosphotransferase enzyme family
3	PF18379 FERM_F1	3.2e-30	115.4	FERM F1 ubiquitin-like domain
4	PF18377 FERM_F2	2.9e-42	155.1	FERM F2 acyl-CoA binding protein-like domain
5	PF17887 Jak1_Phl	1.6e-53	191.9	Jak1 pleckstrin homology-like domain
6	PF06293 Kdo	12	16.8	Lipopolysaccharide kinase (Kdo/WaaP) family
7	PF14531 Kinase-like	3.4	18.5	Kinase-like
8	PF00069 Pkinase	1e-66	236.6	Protein kinase domain
9	PF07714 PK_Tyr_Ser-Thr	1e-128	439.6	Protein tyrosine and serine/threonine kinase
10	PF01163 RIO1	3.5e+02	12.2	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000431885

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270139	0.999	Interferon alpha/beta receptor 1
2	9606.ENSP00000343957	0.999	Interferon alpha/beta receptor 2
3	9606.ENSP00000290200	0.998	Interleukin-10 receptor subunit beta
4	9606.ENSP00000329418	0.998	Suppressor of cytokine signaling 1
5	9606.ENSP00000470788	0.998	Interleukin-12 receptor subunit beta-1
6	9606.ENSP00000354394	0.995	Signal transducer and activator of transcription 1-alpha/beta
7	9606.ENSP00000315768	0.993	Signal transducer and activator of transcription 2
8	9606.ENSP00000264657	0.990	Signal transducer and activator of transcription 3
9	9606.ENSP00000227752	0.985	Interleukin-10 receptor subunit alpha
10	9606.ENSP00000330341	0.982	Suppressor of cytokine signaling 3
11	9606.ENSP00000391592	0.982	Tyrosine-protein phosphatase non-receptor type 6
12	9606.ENSP00000321345	0.981	Interleukin-23 receptor
13	9606.ENSP00000376134	0.981	Signal transducer and activator of transcription 4
14	9606.ENSP00000341208	0.980	Signal transducer and activator of transcription 5A
15	9606.ENSP00000380073	0.978	Interferon regulatory factor 9
16	9606.ENSP00000293328	0.974	Signal transducer and activator of transcription 5B
17	9606.ENSP00000300134	0.974	Signal transducer and activator of transcription 6
18	9606.ENSP00000369581	0.967	Interferon beta
19	9606.ENSP00000385675	0.963	Interleukin-6
20	9606.ENSP00000360683	0.959	Tyrosine-protein phosphatase non-receptor type 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004713	0.999	protein tyrosine kinase activity
GO:0005102	0.998	signaling receptor binding
GO:0005126	0.925	cytokine receptor binding
GO:0051427	0.881	hormone receptor binding
GO:0005131	0.672	growth hormone receptor binding
GO:0004715	0.601	non-membrane spanning protein tyrosine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050896	0.989	response to stimulus
GO:0048522	0.985	positive regulation of cellular process
GO:0050865	0.979	regulation of cell activation
GO:0023052	0.978	signaling
GO:0007154	0.977	cell communication
GO:1903037	0.963	regulation of leukocyte cell-cell adhesion
GO:0070663	0.962	regulation of leukocyte proliferation
GO:0051249	0.957	regulation of lymphocyte activation
GO:0050863	0.952	regulation of T cell activation
GO:0051716	0.946	cellular response to stimulus
GO:0071704	0.945	organic substance metabolic process
GO:0007166	0.914	cell surface receptor signaling pathway
GO:0008284	0.908	positive regulation of cell population proliferation
GO:0019221	0.895	cytokine-mediated signaling pathway
GO:1903039	0.888	positive regulation of leukocyte cell-cell adhesion
GO:0019222	0.879	regulation of metabolic process
GO:0051251	0.870	positive regulation of lymphocyte activation
GO:0044238	0.867	primary metabolic process
GO:0050870	0.860	positive regulation of T cell activation
GO:0032944	0.858	regulation of mononuclear cell proliferation
GO:0048583	0.853	regulation of response to stimulus
GO:0060255	0.849	regulation of macromolecule metabolic process
GO:0009893	0.846	positive regulation of metabolic process
GO:0070665	0.846	positive regulation of leukocyte proliferation
GO:0043170	0.799	macromolecule metabolic process
GO:0044237	0.778	cellular metabolic process
GO:0019538	0.772	protein metabolic process
GO:0050670	0.759	regulation of lymphocyte proliferation
GO:0010604	0.757	positive regulation of macromolecule metabolic process
GO:0036211	0.737	protein modification process
GO:0031323	0.734	regulation of cellular metabolic process
GO:0050671	0.715	positive regulation of lymphocyte proliferation
GO:0042129	0.707	regulation of T cell proliferation
GO:0009966	0.695	regulation of signal transduction
GO:0010468	0.683	regulation of gene expression
GO:0042102	0.678	positive regulation of T cell proliferation
GO:0080090	0.620	regulation of primary metabolic process
GO:0051171	0.615	regulation of nitrogen compound metabolic process
GO:0048519	0.603	negative regulation of biological process
GO:0002376	0.585	immune system process
GO:0048584	0.564	positive regulation of response to stimulus
GO:0016310	0.512	phosphorylation
GO:0001817	0.505	regulation of cytokine production
GO:0031325	0.486	positive regulation of cellular metabolic process
GO:0032501	0.485	multicellular organismal process
GO:0023056	0.473	positive regulation of signaling
GO:0010647	0.472	positive regulation of cell communication
GO:0010628	0.463	positive regulation of gene expression
GO:0006950	0.459	response to stress
GO:0009967	0.459	positive regulation of signal transduction
GO:0009605	0.455	response to external stimulus
GO:0051173	0.448	positive regulation of nitrogen compound metabolic process
GO:0006468	0.412	protein phosphorylation
GO:0001819	0.397	positive regulation of cytokine production
GO:0044419	0.388	biological process involved in interspecies interaction between organisms
GO:0009607	0.386	response to biotic stimulus
GO:0048523	0.384	negative regulation of cellular process
GO:0019219	0.381	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.368	regulation of macromolecule biosynthetic process
GO:0006955	0.365	immune response
GO:0006952	0.351	defense response
GO:0051252	0.345	regulation of RNA metabolic process
GO:0051707	0.343	response to other organism
GO:0031326	0.309	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.964	membrane-bounded organelle
GO:0043231	0.898	intracellular membrane-bounded organelle
GO:0016020	0.869	membrane
GO:0005576	0.777	extracellular region
GO:0031982	0.695	vesicle
GO:0005634	0.658	nucleus
GO:0005615	0.456	extracellular space
GO:0071944	0.359	cell periphery
GO:0031410	0.346	cytoplasmic vesicle
GO:0005886	0.339	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.999	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.601	non-specific protein-tyrosine kinase.

[back to server]