StarFunc result for job id P29692

User Input

>input (281 residues)
MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARARENIQKS
LAGSSGPGASSGTSGDHGELVVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSP
GHRATAPQTQHVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLR
QYAEKKAKKPALVAKSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGI
RKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PRY8	0.378	0.162	1.622E-39	697	1.000	0.403	E9PRY8.pdb.gz	E9PRY8_HUMAN Eukaryotic translation elongation factor 1 delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=1
2	AFDB:B5DEN5	0.427	0.529	4.391E-20	225	0.377	0.471	B5DEN5.pdb.gz
3	AFDB:Q9GRF8	0.346	0.444	1.179E-17	216	0.320	0.417	Q9GRF8.pdb.gz	EF1B_DICDI Elongation factor 1-beta OS=Dictyostelium discoideum OX=44689 GN=efa1B PE=1 SV=1
4	AFDB:P32471	0.363	0.464	7.609E-17	206	0.310	0.422	P32471.pdb.gz	EF1B_YEAST Elongation factor 1-beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EFB1 PE=1 SV=4
5	AFDB:Q6FTV4	0.378	0.505	1.474E-16	207	0.267	0.362	Q6FTV4.pdb.gz	Q6FTV4_CANGA Candida glabrata strain CBS138 chromosome F complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EFB1 PE=3 SV=1
6	AFDB:A0A1D8PM35	0.361	0.468	3.634E-16	213	0.306	0.404	A0A1D8PM35.pdb.gz	A0A1D8PM35_CANAL Translation elongation factor 1 subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EFB1 PE=3 SV=1
7	AFDB:O74173	0.372	0.480	6.244E-16	214	0.288	0.379	O74173.pdb.gz	EF1B_SCHPO Elongation factor 1-beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tef5 PE=2 SV=1
8	AFDB:Q84WM9	0.324	0.397	6.244E-16	228	0.306	0.377	Q84WM9.pdb.gz	EF1B1_ARATH Elongation factor 1-beta 1 OS=Arabidopsis thaliana OX=3702 GN=At5g12110 PE=2 SV=2
9	AFDB:Q9SCX3	0.335	0.414	2.983E-15	224	0.306	0.384	Q9SCX3.pdb.gz	EF1B2_ARATH Elongation factor 1-beta 2 OS=Arabidopsis thaliana OX=3702 GN=At5g19510 PE=1 SV=1
10	AFDB:Q38B20	0.342	0.472	8.291E-15	201	0.256	0.358	Q38B20.pdb.gz	Q38B20_TRYB2 Translation elongation factor 1-beta, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1100 PE=3 SV=1
11	PDB:7w6dA	0.222	0.477	2.148E-3	104	0.046	0.125	7w6dA.pdb.gz	Dual Engineering of Olivetolic Acid Cyclase and Tetraketide Synthase to Generate Longer Alkyl-Chain Olivetolic Acid Analogs.
12	PDB:6mrjB	0.235	0.416	8.067E-3	142	0.071	0.141	6mrjB.pdb.gz	Crystal structure of H.pylori NikR in complex with DNA
13	PDB:7kgbf	0.183	0.395	9.098E-3	95	0.039	0.116	7kgbf.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
14	PDB:6cvlD	0.196	0.168	1.026E-2	344	0.036	0.029	6cvlD.pdb.gz	Noncanonical role for the binding protein in substrate uptake by the MetNI methionine ATP Binding Cassette (ABC) transporter.
15	PDB:4pxdA	0.174	0.130	1.157E-2	411	0.053	0.036	4pxdA.pdb.gz	Structural insights into the substrate specificity of (s)-ureidoglycolate amidohydrolase and its comparison with allantoate amidohydrolase.
16	PDB:1rjjA	0.204	0.407	1.229E-2	111	0.053	0.135	1rjjA.pdb.gz
17	PDB:3j9zSF	0.190	0.317	1.472E-2	135	0.039	0.081	3j9zSF.pdb.gz	Activation of GTP hydrolysis in mRNA-tRNA translocation by elongation factor G.
18	PDB:2j9dB	0.205	0.458	1.660E-2	103	0.028	0.078	2j9dB.pdb.gz	Structure of Glnk1 with Bound Effectors Indicates Regulatory Mechanism for Ammonia Uptake.
19	PDB:4pxbA	0.171	0.126	1.660E-2	423	0.060	0.040	4pxbA.pdb.gz	Structural insights into the substrate specificity of (s)-ureidoglycolate amidohydrolase and its comparison with allantoate amidohydrolase.
20	PDB:1ygyA	0.197	0.114	2.112E-2	527	0.036	0.019	1ygyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PRY8	0.0	570	697	1.000	0.403	E9PRY8_HUMAN Eukaryotic translation elongation factor 1 delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=1
2	P29692	0.0	574	281	1.000	1.000	EF1D_HUMAN Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5
3	A0A087X1X7	1.17e-177	506	631	0.883	0.393	A0A087X1X7_HUMAN Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=1
4	P57776	1.18e-173	482	281	0.922	0.922	EF1D_MOUSE Elongation factor 1-delta OS=Mus musculus OX=10090 GN=Eef1d PE=1 SV=3
5	A0A8I6AEG7	1.23e-67	211	225	0.356	0.444	A0A8I6AEG7_RAT Eukaryotic translation elongation factor 1 beta 2 OS=Rattus norvegicus OX=10116 GN=Eef1b2 PE=1 SV=1
6	P24534	5.68e-64	202	225	0.367	0.458	EF1B_HUMAN Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3
7	O70251	4.82e-63	199	225	0.359	0.449	EF1B_MOUSE Elongation factor 1-beta OS=Mus musculus OX=10090 GN=Eef1b PE=1 SV=5
8	Q9GRF8	8.42e-48	160	216	0.299	0.389	EF1B_DICDI Elongation factor 1-beta OS=Dictyostelium discoideum OX=44689 GN=efa1B PE=1 SV=1
9	Q658K8	1.49e-46	154	133	0.278	0.586	EF1DL_HUMAN Putative elongation factor 1-delta-like protein OS=Homo sapiens OX=9606 GN=EEF1DP3 PE=5 SV=1
10	O74173	1.06e-42	147	214	0.281	0.369	EF1B_SCHPO Elongation factor 1-beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tef5 PE=2 SV=1
11	Q6FTV4	1.61e-39	139	207	0.242	0.329	Q6FTV4_CANGA Candida glabrata strain CBS138 chromosome F complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EFB1 PE=3 SV=1
12	Q84WM9	3.46e-34	125	228	0.295	0.364	EF1B1_ARATH Elongation factor 1-beta 1 OS=Arabidopsis thaliana OX=3702 GN=At5g12110 PE=2 SV=2
13	Q9SI20	1.47e-33	124	231	0.206	0.251	EF1D2_ARATH Elongation factor 1-delta 2 OS=Arabidopsis thaliana OX=3702 GN=At2g18110 PE=1 SV=1
14	A8MRC4	9.87e-33	122	260	0.206	0.223	A8MRC4_ARATH Translation elongation factor EF1B/ribosomal protein S6 family protein OS=Arabidopsis thaliana OX=3702 GN=EEF-1BB1 PE=1 SV=1
15	P32471	1.24e-30	115	206	0.249	0.340	EF1B_YEAST Elongation factor 1-beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EFB1 PE=1 SV=4
16	A0A1D8PM35	2.25e-30	115	213	0.235	0.310	A0A1D8PM35_CANAL Translation elongation factor 1 subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EFB1 PE=3 SV=1
17	Q9SCX3	4.76e-30	114	224	0.203	0.254	EF1B2_ARATH Elongation factor 1-beta 2 OS=Arabidopsis thaliana OX=3702 GN=At5g19510 PE=1 SV=1
18	Q38B20	1.79e-26	104	201	0.174	0.244	Q38B20_TRYB2 Translation elongation factor 1-beta, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1100 PE=3 SV=1
19	Q0V7X4	0.043	37.4	318	0.071	0.063	FIT_ARATH Transcription factor FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR OS=Arabidopsis thaliana OX=3702 GN=FIT PE=1 SV=1
20	F1Q7X5	0.086	37.0	2708	0.096	0.010	F1Q7X5_DANRE Centromere protein F OS=Danio rerio OX=7955 GN=cenpf PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15799 CCD48	28	14.6	Coiled-coil domain-containing protein 48
2	PF10587 EF-1_beta_acid	4.6e-09	47.8	Eukaryotic elongation factor 1 beta central acidic region
3	PF00736 EF1_GNE	1e-32	123.5	EF-1 guanine nucleotide exchange domain
4	PF16471 JIP_LZII	1.9e+02	13.6	JNK-interacting protein leucine zipper II
5	PF14662 KASH_CCD	6.6e+02	11.5	Coiled-coil region of CCDC155 or KASH
6	PF08232 Striatin	3.9	19.4	Striatin family
7	PF16331 TolA_bind_tri	87	14.6	TolA binding protein trimerisation
8	PF08954 Trimer_CC	17	16.4	Trimerisation motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000410059

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331901	0.999	Elongation factor 1-gamma
2	9606.ENSP00000339063	0.997	Elongation factor 1-alpha 1
3	9606.ENSP00000376056	0.997	Elongation factor 1-beta
4	9606.ENSP00000262584	0.982	60S ribosomal protein L8
5	9606.ENSP00000270625	0.980	Ribosomal protein S11
6	9606.ENSP00000477781	0.978	Translationally-controlled tumor protein
7	9606.ENSP00000364815	0.975	Valine--tRNA ligase
8	9606.ENSP00000385958	0.974	Ribosomal protein S14
9	9606.ENSP00000470972	0.974	40S ribosomal protein S19
10	9606.ENSP00000393241	0.971	40S ribosomal protein S18
11	9606.ENSP00000449328	0.967	60S acidic ribosomal protein P0
12	9606.ENSP00000339095	0.965	40S ribosomal protein S7
13	9606.ENSP00000278572	0.964	40S ribosomal protein S3
14	9606.ENSP00000420311	0.964	Ribosomal protein L23
15	9606.ENSP00000307889	0.960	Ribosomal protein L13
16	9606.ENSP00000389103	0.959	60S ribosomal protein L23a
17	9606.ENSP00000375730	0.958	60S ribosomal protein L13a
18	9606.ENSP00000379339	0.958	Ribosomal protein S29
19	9606.ENSP00000311430	0.955	L ribosomal proteins
20	9606.ENSP00000362744	0.955	Ribosomal protein S4, X-linked

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.997	nucleic acid binding
GO:0045182	0.993	translation regulator activity
GO:0050839	0.992	cell adhesion molecule binding
GO:0008134	0.968	transcription factor binding
GO:0090079	0.921	translation regulator activity, nucleic acid binding
GO:0008135	0.883	translation factor activity, RNA binding
GO:0031072	0.830	heat shock protein binding
GO:0045296	0.768	cadherin binding
GO:0140297	0.634	DNA-binding transcription factor binding
GO:0003677	0.605	DNA binding
GO:0008092	0.533	cytoskeletal protein binding
GO:0003723	0.312	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008152	0.978	metabolic process
GO:0044237	0.946	cellular metabolic process
GO:0006807	0.911	nitrogen compound metabolic process
GO:0071704	0.888	organic substance metabolic process
GO:0044238	0.862	primary metabolic process
GO:0043170	0.772	macromolecule metabolic process
GO:0034641	0.736	cellular nitrogen compound metabolic process
GO:0010467	0.733	gene expression
GO:0009059	0.724	macromolecule biosynthetic process
GO:0044271	0.705	cellular nitrogen compound biosynthetic process
GO:0065007	0.594	biological regulation
GO:0050789	0.556	regulation of biological process
GO:0048522	0.539	positive regulation of cellular process
GO:0048583	0.507	regulation of response to stimulus
GO:1902533	0.493	positive regulation of intracellular signal transduction
GO:0006725	0.435	cellular aromatic compound metabolic process
GO:1901360	0.433	organic cyclic compound metabolic process
GO:0010941	0.433	regulation of cell death
GO:0071479	0.428	cellular response to ionizing radiation
GO:0006351	0.416	DNA-templated transcription
GO:0016071	0.392	mRNA metabolic process
GO:0009299	0.379	mRNA transcription
GO:0043122	0.337	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043123	0.333	positive regulation of I-kappaB kinase/NF-kappaB signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0031981	0.989	nuclear lumen
GO:0005829	0.987	cytosol
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0032991	0.924	protein-containing complex
GO:0005654	0.879	nucleoplasm
GO:0005730	0.652	nucleolus
GO:0012505	0.605	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]