StarFunc result for job id P29965

User Input

>input (261 residues)
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNP
QIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSN
REASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVN
VTDPSQVSHGTGFTSFGLLKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P29965	1.000	1.000	8.672E-46	261	1.000	1.000	P29965.pdb.gz	CD40L_HUMAN CD40 ligand OS=Homo sapiens OX=9606 GN=CD40LG PE=1 SV=1
2	AFDB:P27548	0.632	0.632	5.156E-37	260	0.770	0.773	P27548.pdb.gz	CD40L_MOUSE CD40 ligand OS=Mus musculus OX=10090 GN=Cd40lg PE=1 SV=2
3	AFDB:B9ENV6	0.508	0.502	2.130E-15	264	0.241	0.239	B9ENV6.pdb.gz	B9ENV6_SALSA CD40 ligand OS=Salmo salar OX=8030 GN=CD40L PE=2 SV=1
4	AFDB:A0A0U5J7B5	0.472	0.424	8.778E-15	292	0.218	0.195	A0A0U5J7B5.pdb.gz	A0A0U5J7B5_RAT Tumor necrosis factor ligand superfamily member OS=Rattus norvegicus OX=10116 GN=Tnfsf10 PE=2 SV=1
5	AFDB:P50592	0.472	0.426	1.091E-14	291	0.199	0.179	P50592.pdb.gz	TNF10_MOUSE Tumor necrosis factor ligand superfamily member 10 OS=Mus musculus OX=10090 GN=Tnfsf10 PE=2 SV=1
6	AFDB:P50591	0.462	0.431	3.425E-14	281	0.222	0.206	P50591.pdb.gz	TNF10_HUMAN Tumor necrosis factor ligand superfamily member 10 OS=Homo sapiens OX=9606 GN=TNFSF10 PE=1 SV=1
7	AFDB:B8YI05	0.584	0.586	5.295E-14	260	0.238	0.238	B8YI05.pdb.gz	B8YI05_DANRE CD154 OS=Danio rerio OX=7955 GN=cd40lg PE=2 SV=1
8	AFDB:F1Q767	0.474	0.396	1.336E-13	317	0.241	0.199	F1Q767.pdb.gz
9	AFDB:O14788	0.476	0.397	3.194E-13	317	0.241	0.199	O14788.pdb.gz	TNF11_HUMAN Tumor necrosis factor ligand superfamily member 11 OS=Homo sapiens OX=9606 GN=TNFSF11 PE=1 SV=1
10	AFDB:Q9DEP9	0.487	0.498	8.511E-13	255	0.192	0.196	Q9DEP9.pdb.gz	Q9DEP9_ONCMY Tumor necrosis factor OS=Oncorhynchus mykiss OX=8022 GN=tnf PE=2 SV=1
11	PDB:7e57B	0.342	0.682	2.982E-6	123	0.092	0.195	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
12	PDB:5kc6B	0.405	0.688	6.053E-6	144	0.077	0.139	5kc6B.pdb.gz
13	PDB:5h4bA	0.396	0.710	7.527E-6	136	0.077	0.147	5h4bA.pdb.gz
14	PDB:5vqfB	0.227	0.193	2.290E-3	320	0.080	0.066	5vqfB.pdb.gz
15	PDB:6xwuA	0.165	0.252	2.554E-3	138	0.034	0.065	6xwuA.pdb.gz
16	PDB:7y4sA	0.197	0.163	3.739E-3	343	0.134	0.102	7y4sA.pdb.gz
17	PDB:4fixA	0.243	0.117	4.169E-3	629	0.073	0.030	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
18	PDB:6xwvD	0.172	0.283	5.780E-3	123	0.046	0.098	6xwvD.pdb.gz	Structural basis for centromere maintenance by Drosophila CENP-A chaperone CAL1.
19	PDB:6ds5A	0.262	0.379	8.013E-3	160	0.061	0.100	6ds5A.pdb.gz
20	PDB:4tlgA	0.158	0.113	1.111E-2	396	0.050	0.033	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P29965	0.0	545	261	1.000	1.000	CD40L_HUMAN CD40 ligand OS=Homo sapiens OX=9606 GN=CD40LG PE=1 SV=1
2	P27548	4.18e-150	421	260	0.774	0.777	CD40L_MOUSE CD40 ligand OS=Mus musculus OX=10090 GN=Cd40lg PE=1 SV=2
3	Q9Z2V2	1.44e-142	402	260	0.762	0.765	CD40L_RAT CD40 ligand OS=Rattus norvegicus OX=10116 GN=Cd40lg PE=2 SV=2
4	O35235	4.01e-08	55.5	316	0.172	0.142	TNF11_MOUSE Tumor necrosis factor ligand superfamily member 11 OS=Mus musculus OX=10090 GN=Tnfsf11 PE=1 SV=2
5	B9ENV6	4.30e-08	55.1	264	0.234	0.231	B9ENV6_SALSA CD40 ligand OS=Salmo salar OX=8030 GN=CD40L PE=2 SV=1
6	Q9ESE2	1.64e-07	53.5	318	0.161	0.132	TNF11_RAT Tumor necrosis factor ligand superfamily member 11 OS=Rattus norvegicus OX=10116 GN=Tnfsf11 PE=2 SV=1
7	O14788	2.34e-06	50.1	317	0.215	0.177	TNF11_HUMAN Tumor necrosis factor ligand superfamily member 11 OS=Homo sapiens OX=9606 GN=TNFSF11 PE=1 SV=1
8	P01375	7.71e-06	48.1	233	0.199	0.223	TNFA_HUMAN Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1
9	C1K3N5	8.02e-06	48.1	232	0.199	0.224	C1K3N5_HUMAN Tumor necrosis factor (Fragment) OS=Homo sapiens OX=9606 GN=TNF PE=2 SV=1
10	P50591	1.23e-05	47.8	281	0.249	0.231	TNF10_HUMAN Tumor necrosis factor ligand superfamily member 10 OS=Homo sapiens OX=9606 GN=TNFSF10 PE=1 SV=1
11	B8YI05	6.00e-05	45.4	260	0.218	0.219	B8YI05_DANRE CD154 OS=Danio rerio OX=7955 GN=cd40lg PE=2 SV=1
12	Q7ZYX9	7.05e-05	45.8	317	0.165	0.136	Q7ZYX9_DANRE TNF superfamily member 10, like OS=Danio rerio OX=7955 GN=wu:fc12f06 PE=2 SV=1
13	P50592	1.43e-04	44.7	291	0.241	0.216	TNF10_MOUSE Tumor necrosis factor ligand superfamily member 10 OS=Mus musculus OX=10090 GN=Tnfsf10 PE=2 SV=1
14	A0A0U5J7B5	3.17e-04	43.5	292	0.161	0.144	A0A0U5J7B5_RAT Tumor necrosis factor ligand superfamily member OS=Rattus norvegicus OX=10116 GN=Tnfsf10 PE=2 SV=1
15	A0A8I5ZY27	4.16e-04	43.1	289	0.157	0.142	A0A8I5ZY27_RAT Tumor necrosis factor ligand superfamily member OS=Rattus norvegicus OX=10116 GN=Tnfsf10 PE=3 SV=1
16	Q06643	7.28e-04	42.4	244	0.172	0.184	TNFC_HUMAN Lymphotoxin-beta OS=Homo sapiens OX=9606 GN=LTB PE=1 SV=1
17	Q06599	0.001	41.6	234	0.165	0.184	TNFA_BOVIN Tumor necrosis factor OS=Bos taurus OX=9913 GN=TNF PE=2 SV=2
18	P36940	0.002	41.2	278	0.165	0.155	TNFL6_RAT Tumor necrosis factor ligand superfamily member 6 OS=Rattus norvegicus OX=10116 GN=Faslg PE=2 SV=1
19	P41047	0.003	40.8	279	0.172	0.161	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
20	P41155	0.003	40.8	306	0.176	0.150	TNFC_MOUSE Lymphotoxin-beta OS=Mus musculus OX=10090 GN=Ltb PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03455 dDENN	3.1e+02	12.8	dDENN domain
2	PF18928 DUF5677	1.4e+02	14.0	Family of unknown function (DUF5677)
3	PF00229 TNF	4.5e-26	102.7	TNF(Tumour Necrosis Factor) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359663

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361359	0.999	Tumor necrosis factor receptor superfamily member 5
2	9606.ENSP00000441691	0.994	Integrin alpha-M
3	9606.ENSP00000247668	0.972	TNF receptor-associated factor 2
4	9606.ENSP00000380948	0.972	Integrin beta-2
5	9606.ENSP00000362994	0.966	TNF receptor-associated factor 1
6	9606.ENSP00000454207	0.956	TNF receptor-associated factor 3
7	9606.ENSP00000433623	0.955	TNF receptor-associated factor 6
8	9606.ENSP00000384273	0.952	Transcription factor p65
9	9606.ENSP00000477613	0.951	Baculoviral IAP repeat-containing protein 2
10	9606.ENSP00000216797	0.949	NF-kappa-B inhibitor alpha
11	9606.ENSP00000263464	0.947	Baculoviral IAP repeat-containing protein 3
12	9606.ENSP00000319476	0.947	Inducible T-cell costimulator
13	9606.ENSP00000451828	0.947	RAC-alpha serine/threonine-protein kinase
14	9606.ENSP00000341208	0.943	Signal transducer and activator of transcription 5A
15	9606.ENSP00000391676	0.940	Tyrosine-protein kinase JAK3
16	9606.ENSP00000226574	0.935	Nuclear factor NF-kappa-B p105 subunit
17	9606.ENSP00000231449	0.934	Interleukin-4
18	9606.ENSP00000398698	0.928	Tumor necrosis factor
19	9606.ENSP00000367440	0.927	Tyrosyl-DNA phosphodiesterase 2
20	9606.ENSP00000229795	0.925	Mitogen-activated protein kinase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032813	1.000	tumor necrosis factor receptor superfamily binding
GO:0140677	0.996	molecular function activator activity
GO:0005174	0.969	CD40 receptor binding
GO:0030234	0.873	enzyme regulator activity
GO:0044877	0.859	protein-containing complex binding
GO:0019887	0.847	protein kinase regulator activity
GO:0019209	0.847	kinase activator activity
GO:0043539	0.839	protein serine/threonine kinase activator activity
GO:0050839	0.829	cell adhesion molecule binding
GO:0005178	0.823	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0048522	0.994	positive regulation of cellular process
GO:0051239	0.990	regulation of multicellular organismal process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0051716	0.982	cellular response to stimulus
GO:0042127	0.980	regulation of cell population proliferation
GO:0010468	0.980	regulation of gene expression
GO:0050865	0.978	regulation of cell activation
GO:0002376	0.967	immune system process
GO:0002684	0.960	positive regulation of immune system process
GO:0010604	0.958	positive regulation of macromolecule metabolic process
GO:0032502	0.953	developmental process
GO:0051240	0.945	positive regulation of multicellular organismal process
GO:0002694	0.945	regulation of leukocyte activation
GO:0001817	0.941	regulation of cytokine production
GO:0051251	0.940	positive regulation of lymphocyte activation
GO:0050670	0.939	regulation of lymphocyte proliferation
GO:0070665	0.936	positive regulation of leukocyte proliferation
GO:0032501	0.934	multicellular organismal process
GO:0032946	0.932	positive regulation of mononuclear cell proliferation
GO:0023052	0.931	signaling
GO:0007154	0.925	cell communication
GO:0007165	0.922	signal transduction
GO:0001775	0.921	cell activation
GO:0001819	0.920	positive regulation of cytokine production
GO:0046649	0.899	lymphocyte activation
GO:1903037	0.894	regulation of leukocyte cell-cell adhesion
GO:0032655	0.886	regulation of interleukin-12 production
GO:0048583	0.876	regulation of response to stimulus
GO:0050671	0.859	positive regulation of lymphocyte proliferation
GO:1903039	0.857	positive regulation of leukocyte cell-cell adhesion
GO:0050863	0.846	regulation of T cell activation
GO:0009889	0.837	regulation of biosynthetic process
GO:0010556	0.832	regulation of macromolecule biosynthetic process
GO:0010033	0.819	response to organic substance
GO:0042981	0.806	regulation of apoptotic process
GO:0048869	0.800	cellular developmental process
GO:0006355	0.780	regulation of DNA-templated transcription
GO:0007166	0.770	cell surface receptor signaling pathway
GO:0006950	0.765	response to stress
GO:0032653	0.748	regulation of interleukin-10 production
GO:0048519	0.742	negative regulation of biological process
GO:0042129	0.738	regulation of T cell proliferation
GO:0048523	0.720	negative regulation of cellular process
GO:0032733	0.719	positive regulation of interleukin-10 production
GO:0042113	0.712	B cell activation
GO:0065009	0.687	regulation of molecular function
GO:0048856	0.674	anatomical structure development
GO:0006955	0.601	immune response
GO:0044093	0.594	positive regulation of molecular function
GO:0048584	0.566	positive regulation of response to stimulus
GO:0050870	0.529	positive regulation of T cell activation
GO:0008283	0.484	cell population proliferation
GO:0051173	0.460	positive regulation of nitrogen compound metabolic process
GO:0070887	0.447	cellular response to chemical stimulus
GO:0030154	0.409	cell differentiation
GO:0043065	0.403	positive regulation of apoptotic process
GO:0009605	0.400	response to external stimulus
GO:0006952	0.397	defense response
GO:0051090	0.393	regulation of DNA-binding transcription factor activity
GO:0008152	0.387	metabolic process
GO:0071704	0.371	organic substance metabolic process
GO:0048468	0.368	cell development
GO:0065008	0.342	regulation of biological quality
GO:0051091	0.340	positive regulation of DNA-binding transcription factor activity
GO:0044238	0.339	primary metabolic process
GO:0050776	0.317	regulation of immune response
GO:0031325	0.310	positive regulation of cellular metabolic process
GO:0010646	0.307	regulation of cell communication
GO:0071310	0.307	cellular response to organic substance
GO:0034097	0.306	response to cytokine

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	1.000	cell surface
GO:0005886	1.000	plasma membrane
GO:0012505	0.996	endomembrane system
GO:0005622	0.969	intracellular anatomical structure
GO:0043227	0.967	membrane-bounded organelle
GO:0043231	0.955	intracellular membrane-bounded organelle
GO:0005737	0.936	cytoplasm
GO:0005794	0.673	Golgi apparatus
GO:0005576	0.394	extracellular region
GO:0070013	0.367	intracellular organelle lumen
GO:0005615	0.303	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]