StarFunc result for job id P30038

User Input

>input (563 residues)
MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGR
MEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKP
IADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVEL
EGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAML
ASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQ
NLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACSRLYVPHSL
WPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGK
CDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTG
AVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILR
WTSPQVIKETHKPLGDWSYAYMQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4e3xB	0.967	0.997	0.000	546	0.892	0.919	4e3xB.pdb.gz	Proline: Mother Nature's cryoprotectant applied to protein crystallography.
2	AFDB:A0A024RAC7	0.993	0.993	0.000	563	1.000	1.000	A0A024RAC7.pdb.gz	A0A024RAC7_HUMAN Multifunctional fusion protein OS=Homo sapiens OX=9606 PE=2 SV=1
3	PDB:4oe5D	0.888	0.985	1.772E-95	507	0.901	1.000	4oe5D.pdb.gz
4	AFDB:Q8T3P0	0.964	0.946	1.994E-87	574	0.590	0.578	Q8T3P0.pdb.gz	Q8T3P0_DROME Multifunctional fusion protein OS=Drosophila melanogaster OX=7227 GN=P5CDh1 PE=2 SV=1
5	PDB:3v9iD	0.846	0.987	2.710E-84	482	0.853	0.996	3v9iD.pdb.gz
6	AFDB:Q9P8I0	0.936	0.922	8.366E-75	572	0.469	0.462	Q9P8I0.pdb.gz	PUT2_EMENI Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=prnC PE=3 SV=2
7	AFDB:O74766	0.944	0.969	2.885E-73	548	0.469	0.482	O74766.pdb.gz	PUT2_SCHPO Probable delta-1-pyrroline-5-carboxylate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC24C6.04 PE=1 SV=1
8	AFDB:Q5AK46	0.940	0.890	9.569E-73	595	0.449	0.425	Q5AK46.pdb.gz	Q5AK46_CANAL Multifunctional fusion protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PUT2 PE=3 SV=1
9	AFDB:Q38BS5	0.933	0.936	2.128E-72	561	0.455	0.456	Q38BS5.pdb.gz	Q38BS5_TRYB2 Multifunctional fusion protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4280 PE=3 SV=1
10	AFDB:P07275	0.937	0.918	2.390E-69	575	0.416	0.407	P07275.pdb.gz	PUT2_YEAST Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUT2 PE=1 SV=2
11	PDB:4oe6B	0.815	0.941	3.801E-56	486	0.368	0.426	4oe6B.pdb.gz
12	AFDB:P94391	0.884	0.965	7.700E-52	515	0.290	0.317	P94391.pdb.gz	ROCA2_BACSU 1-pyrroline-5-carboxylate dehydrogenase 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=putC PE=2 SV=2
13	AFDB:Q9I5F6	0.839	0.451	8.500E-45	1060	0.266	0.142	Q9I5F6.pdb.gz	Q9I5F6_PSEAE Bifunctional protein PutA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=putA PE=3 SV=1
14	PDB:4fr8C	0.768	0.868	2.208E-39	496	0.211	0.240	4fr8C.pdb.gz	Vascular Bioactivation of Nitroglycerin by Aldehyde Dehydrogenase-2: REACTION INTERMEDIATES REVEALED BY CRYSTALLOGRAPHY AND MASS SPECTROMETRY.
15	PDB:5izdA	0.764	0.865	3.111E-39	494	0.222	0.253	5izdA.pdb.gz	Structure of wild-type glyceraldehyde dehydrogenase from Thermoplasma acidophilum in complex with NADP
16	AFDB:B3DKM0	0.776	0.840	4.297E-39	518	0.227	0.247	B3DKM0.pdb.gz
17	PDB:3hazA	0.771	0.448	3.837E-38	983	0.259	0.149	3hazA.pdb.gz	Crystal structure of the bifunctional proline utilization A flavoenzyme from Bradyrhizobium japonicum
18	PDB:7mjcA	0.773	0.878	4.301E-38	493	0.210	0.239	7mjcA.pdb.gz	Inhibitors targeted to aldehyde dehydrogenase
19	PDB:7yobA	0.783	0.888	4.822E-38	494	0.211	0.241	7yobA.pdb.gz
20	PDB:5abmA	0.780	0.884	1.072E-37	494	0.211	0.241	5abmA.pdb.gz	Structural, Biochemical, and Computational Studies Reveal the Mechanism of Selective Aldehyde Dehydrogenase 1A1 Inhibition by Cytotoxic Duocarmycin Analogues.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024RAC7	0.0	1167	563	1.000	1.000	A0A024RAC7_HUMAN Multifunctional fusion protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	P30038	0.0	1167	563	1.000	1.000	AL4A1_HUMAN Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH4A1 PE=1 SV=3
3	Q8CHT0	0.0	1098	562	0.917	0.918	AL4A1_MOUSE Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh4a1 PE=1 SV=3
4	Q8T3P0	0.0	685	574	0.583	0.571	Q8T3P0_DROME Multifunctional fusion protein OS=Drosophila melanogaster OX=7227 GN=P5CDh1 PE=2 SV=1
5	Q9VNX4	0.0	684	574	0.583	0.571	Q9VNX4_DROME Multifunctional fusion protein OS=Drosophila melanogaster OX=7227 GN=P5CDh1 PE=1 SV=1
6	O74766	1.15e-178	517	548	0.467	0.480	PUT2_SCHPO Probable delta-1-pyrroline-5-carboxylate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC24C6.04 PE=1 SV=1
7	Q9P8I0	3.19e-172	501	572	0.474	0.467	PUT2_EMENI Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=prnC PE=3 SV=2
8	Q38BS5	3.73e-171	498	561	0.451	0.453	Q38BS5_TRYB2 Multifunctional fusion protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4280 PE=3 SV=1
9	Q5AK46	1.18e-168	493	595	0.446	0.422	Q5AK46_CANAL Multifunctional fusion protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PUT2 PE=3 SV=1
10	P07275	8.05e-145	431	575	0.423	0.414	PUT2_YEAST Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUT2 PE=1 SV=2
11	Q5TF55	1.98e-143	414	214	0.373	0.981	Q5TF55_HUMAN Aldehyde dehydrogenase 4 family member A1 (Fragment) OS=Homo sapiens OX=9606 GN=ALDH4A1 PE=1 SV=1
12	P94391	4.84e-70	236	515	0.295	0.322	ROCA2_BACSU 1-pyrroline-5-carboxylate dehydrogenase 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=putC PE=2 SV=2
13	Q9I5F6	1.65e-57	210	1060	0.261	0.139	Q9I5F6_PSEAE Bifunctional protein PutA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=putA PE=3 SV=1
14	P09546	1.62e-47	181	1320	0.277	0.118	PUTA_ECOLI Bifunctional protein PutA OS=Escherichia coli (strain K12) OX=83333 GN=putA PE=1 SV=3
15	P10503	3.89e-46	176	1320	0.247	0.105	PUTA_SALTY Bifunctional protein PutA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=putA PE=2 SV=4
16	Q9DD46	1.47e-43	164	512	0.243	0.268	Q9DD46_CHICK Aldehyde dehydrogenase OS=Gallus gallus OX=9031 GN=ALDH6 PE=2 SV=1
17	Q89E26	3.23e-43	167	999	0.245	0.138	Q89E26_BRADU Bifunctional protein PutA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=putA PE=1 SV=1
18	Q9JHW9	2.01e-42	161	512	0.236	0.260	AL1A3_MOUSE Retinaldehyde dehydrogenase 3 OS=Mus musculus OX=10090 GN=Aldh1a3 PE=1 SV=1
19	Q8K4D8	3.79e-42	160	512	0.238	0.262	AL1A3_RAT Retinaldehyde dehydrogenase 3 OS=Rattus norvegicus OX=10116 GN=Aldh1a3 PE=2 SV=1
20	Q6L285	3.80e-42	160	493	0.211	0.241	GADH_PICTO D-glyceraldehyde dehydrogenase (NADP(+)) OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3) OX=1122961 GN=PTO0332 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00171 Aldedh	2.8e-100	347.7	Aldehyde dehydrogenase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364490

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000481127	0.995	Proline dehydrogenase 1, mitochondrial
2	9606.ENSP00000349577	0.994	Proline dehydrogenase
3	9606.ENSP00000360268	0.992	Delta-1-pyrroline-5-carboxylate synthase
4	9606.ENSP00000301175	0.982	Hydroxyproline dehydrogenase
5	9606.ENSP00000357838	0.982	Ornithine aminotransferase, mitochondrial
6	9606.ENSP00000384949	0.979	Pyrroline-5-carboxylate reductase 1, mitochondrial
7	9606.ENSP00000342502	0.966	Pyrroline-5-carboxylate reductase 2
8	9606.ENSP00000277865	0.965	Glutamate dehydrogenase 1, mitochondrial
9	9606.ENSP00000220966	0.963	Pyrroline-5-carboxylate reductase 3
10	9606.ENSP00000307900	0.959	Glutamine synthetase
11	9606.ENSP00000359539	0.955	Aspartate aminotransferase, cytoplasmic
12	9606.ENSP00000327589	0.952	Glutamate dehydrogenase 2, mitochondrial
13	9606.ENSP00000310447	0.950	Glutaminase liver isoform, mitochondrial
14	9606.ENSP00000350928	0.937	Glutamate decarboxylase 1
15	9606.ENSP00000245206	0.936	Aspartate aminotransferase, mitochondrial
16	9606.ENSP00000303077	0.929	Putative aspartate aminotransferase, cytoplasmic 2
17	9606.ENSP00000317379	0.920	Glutaminase kidney isoform, mitochondrial
18	9606.ENSP00000365437	0.920	Glutamate decarboxylase 2
19	9606.ENSP00000370737	0.881	Glycine dehydrogenase (decarboxylating), mitochondrial
20	9606.ENSP00000387123	0.864	Alpha-aminoadipic semialdehyde dehydrogenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016620	1.000	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0005488	0.985	binding
GO:0004030	0.984	aldehyde dehydrogenase [NAD(P)+] activity
GO:0005515	0.975	protein binding
GO:0004029	0.934	aldehyde dehydrogenase (NAD+) activity
GO:0042802	0.335	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0019752	0.966	carboxylic acid metabolic process
GO:0006807	0.952	nitrogen compound metabolic process
GO:0006520	0.917	amino acid metabolic process
GO:0046395	0.903	carboxylic acid catabolic process
GO:0009064	0.866	glutamine family amino acid metabolic process
GO:0006560	0.730	proline metabolic process
GO:1901565	0.724	organonitrogen compound catabolic process
GO:0009063	0.653	amino acid catabolic process
GO:0006575	0.613	cellular modified amino acid metabolic process
GO:1901606	0.559	alpha-amino acid catabolic process
GO:0042219	0.495	cellular modified amino acid catabolic process
GO:1901360	0.336	organic cyclic compound metabolic process
GO:0050896	0.312	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0005829	0.951	cytosol
GO:0070013	0.761	intracellular organelle lumen
GO:0005759	0.481	mitochondrial matrix
GO:0031981	0.343	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.2.1.-	1.000	With NAD(+) or NADP(+) as acceptor.
EC:1.2.1.5	0.984	aldehyde dehydrogenase [NAD(P)(+)].
RHEA:16185	0.934	an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH
EC:1.2.1.3	0.934	aldehyde dehydrogenase (NAD(+)).

[back to server]