StarFunc result for job id P30039

User Input

>input (288 residues)
MKLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIRKLHPTDNFA
QSSCFGLRWFTPASEVPLCGHATLASAAVLFHKIKNMNSTLTFVTLSGELRARRAEDGIV
LDLPLYPAHPQDFHEVEDLIKTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVN
TENLLQVENTGKVKGLILTLKGEPGGQTQAFDFYSRYFAPWVGVAEDPVTGSAHAVLSSY
WSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAVVLEGTLTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30039	1.000	1.000	9.310E-71	288	1.000	1.000	P30039.pdb.gz	PBLD_HUMAN Phenazine biosynthesis-like domain-containing protein OS=Homo sapiens OX=9606 GN=PBLD PE=1 SV=2
2	AFDB:Q66GM9	0.872	0.822	1.501E-30	306	0.319	0.301	Q66GM9.pdb.gz	Q66GM9_ARATH At4g02850 OS=Arabidopsis thaliana OX=3702 GN=DAAR1 PE=1 SV=1
3	AFDB:P38765	0.815	0.800	3.711E-26	294	0.267	0.262	P38765.pdb.gz	YHI9_YEAST Uncharacterized isomerase YHI9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHI9 PE=1 SV=1
4	PDB:1ym5A	0.807	0.793	3.012E-24	294	0.264	0.259	1ym5A.pdb.gz
5	AFDB:Q8NIL3	0.799	0.779	1.963E-22	296	0.250	0.243	Q8NIL3.pdb.gz	AES1_SCHPO Antisense-enhancing sequence 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aes1 PE=3 SV=1
6	AFDB:O69754	0.758	0.783	1.127E-19	278	0.243	0.252	O69754.pdb.gz	PHZF_PSEAE Trans-2,3-dihydro-3-hydroxyanthranilate isomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=phzF1 PE=3 SV=2
7	PDB:4juuA	0.646	0.598	2.506E-15	315	0.177	0.162	4juuA.pdb.gz
8	PDB:4jd7A	0.680	0.629	5.253E-15	314	0.188	0.172	4jd7A.pdb.gz
9	AFDB:Q8P833	0.608	0.568	8.996E-15	312	0.174	0.160	Q8P833.pdb.gz	4HYPE_XANCP 4-hydroxyproline 2-epimerase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC2415 PE=1 SV=1
10	AFDB:A5VZY6	0.611	0.578	1.773E-14	308	0.188	0.175	A5VZY6.pdb.gz	4HYPE_PSEP1 4-hydroxyproline 2-epimerase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=Pput_1285 PE=1 SV=1
11	AFDB:Q9I476	0.599	0.557	1.886E-14	314	0.205	0.188	Q9I476.pdb.gz	4HYPE_PSEAE 4-hydroxyproline 2-epimerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1268 PE=1 SV=1
12	AFDB:A0NXQ7	0.586	0.551	2.006E-14	310	0.167	0.155	A0NXQ7.pdb.gz	4HYPE_ROSAI 4-hydroxyproline 2-epimerase OS=Roseibium aggregatum (strain ATCC 25650 / DSM 13394 / JCM 20685 / NBRC 16684 / NCIMB 2208 / IAM 12614 / B1) OX=384765 GN=SIAM614_28492 PE=1 SV=1
13	AFDB:Q2T3J4	0.637	0.598	4.757E-14	310	0.177	0.165	Q2T3J4.pdb.gz	4HYPE_BURTA 4-hydroxyproline 2-epimerase OS=Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264) OX=271848 GN=BTH_II2067 PE=1 SV=1
14	PDB:2azpA	0.636	0.585	9.939E-13	318	0.163	0.148	2azpA.pdb.gz
15	PDB:7vdyA	0.574	0.580	1.057E-12	285	0.153	0.154	7vdyA.pdb.gz
16	PDB:4ijzB	0.622	0.647	2.667E-12	275	0.177	0.185	4ijzB.pdb.gz
17	PDB:4k7gD	0.544	0.461	5.945E-12	352	0.163	0.134	4k7gD.pdb.gz	Crystal structure of a 3-hydroxyproline dehydratse from agrobacterium vitis, target efi-506470, with bound pyrrole 2-carboxylate, ordered active site
18	PDB:7qpoB	0.610	0.533	4.841E-11	337	0.149	0.128	7qpoB.pdb.gz
19	PDB:3fveA	0.597	0.606	2.837E-9	283	0.122	0.124	3fveA.pdb.gz
20	PDB:3g7kB	0.493	0.391	3.018E-9	387	0.167	0.124	3g7kB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30039	0.0	600	288	1.000	1.000	PBLD_HUMAN Phenazine biosynthesis-like domain-containing protein OS=Homo sapiens OX=9606 GN=PBLD PE=1 SV=2
2	Q66GM9	5.43e-35	130	306	0.351	0.330	Q66GM9_ARATH At4g02850 OS=Arabidopsis thaliana OX=3702 GN=DAAR1 PE=1 SV=1
3	P38765	3.51e-15	76.3	294	0.292	0.286	YHI9_YEAST Uncharacterized isomerase YHI9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHI9 PE=1 SV=1
4	Q8NIL3	8.22e-15	75.1	296	0.260	0.253	AES1_SCHPO Antisense-enhancing sequence 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aes1 PE=3 SV=1
5	O69754	5.46e-10	61.2	278	0.236	0.245	PHZF_PSEAE Trans-2,3-dihydro-3-hydroxyanthranilate isomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=phzF1 PE=3 SV=2
6	O96167	2.3	32.3	994	0.101	0.029	O96167_PLAF7 Serine repeat antigen 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0208000 PE=3 SV=2
7	Q9HU50	3.4	31.6	436	0.049	0.032	Q9HU50_PSEAE Probable carboxyl-terminal protease OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA5134 PE=1 SV=1
8	P38750	3.6	31.6	627	0.042	0.019	YHA8_YEAST Uncharacterized transporter YHL008C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHL008C PE=1 SV=1
9	Q9I476	3.8	31.2	314	0.069	0.064	4HYPE_PSEAE 4-hydroxyproline 2-epimerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1268 PE=1 SV=1
10	Q99MS4	4.2	31.2	279	0.045	0.047	PRS29_MOUSE Serine protease 29 OS=Mus musculus OX=10090 GN=Prss29 PE=1 SV=2
11	Q5BIH1	6.2	30.8	803	0.090	0.032	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
12	Q9VTD3	6.2	30.8	803	0.090	0.032	Q9VTD3_DROME FI01015p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=2
13	A9AQW9	6.3	30.8	338	0.059	0.050	4HPE2_BURM1 4-hydroxyproline 2-epimerase 2 OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=prdF PE=1 SV=1
14	M9PF84	7.4	30.8	818	0.090	0.032	M9PF84_DROME Klumpfuss, isoform B OS=Drosophila melanogaster OX=7227 GN=klu PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02567 PhzC-PhzF	4.2e-58	208.6	Phenazine biosynthesis-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351619

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392270	0.962	Serine-threonine kinase receptor-associated protein
2	9606.ENSP00000351790	0.658	Myopalladin
3	9606.ENSP00000476815	0.632	Graves disease carrier protein
4	9606.ENSP00000373420	0.610	RUN and FYVE domain containing 2
5	9606.ENSP00000363478	0.579	Belongs to the UPF0220 family
6	9606.ENSP00000334375	0.543	Leucine rich repeats and calponin homology domain containing 3
7	9606.ENSP00000362777	0.532	Protein atonal homolog 7
8	9606.ENSP00000299213	0.514	La-related protein 6
9	9606.ENSP00000458663	0.509	Protein capicua homolog
10	9606.ENSP00000363317	0.508	FERM and PDZ domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003824	0.885	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0048583	0.981	regulation of response to stimulus
GO:0050794	0.978	regulation of cellular process
GO:0009966	0.966	regulation of signal transduction
GO:0048523	0.961	negative regulation of cellular process
GO:0032501	0.952	multicellular organismal process
GO:0090092	0.947	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007586	0.937	digestion
GO:1903844	0.936	regulation of cellular response to transforming growth factor beta stimulus
GO:0010669	0.936	epithelial structure maintenance
GO:0090101	0.936	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0017015	0.896	regulation of transforming growth factor beta receptor signaling pathway
GO:0030277	0.892	maintenance of gastrointestinal epithelium
GO:0030512	0.892	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0009987	0.719	cellular process
GO:1902531	0.536	regulation of intracellular signal transduction
GO:0008152	0.524	metabolic process
GO:0044237	0.462	cellular metabolic process
GO:0071704	0.433	organic substance metabolic process
GO:1902532	0.389	negative regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0070062	0.995	extracellular exosome
GO:0043231	0.925	intracellular membrane-bounded organelle
GO:0005829	0.694	cytosol
GO:0005634	0.500	nucleus
GO:0070013	0.339	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]