StarFunc result for job id P30040

User Input

>input (261 residues)
MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKF
DTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYL
FRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQAL
LKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEE
LQKSLNILTAFQKKGAEKEEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30040	1.000	1.000	4.669E-47	261	1.000	1.000	P30040.pdb.gz	ERP29_HUMAN Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4
2	AFDB:P57759	0.899	0.895	2.810E-41	262	0.885	0.882	P57759.pdb.gz	ERP29_MOUSE Endoplasmic reticulum resident protein 29 OS=Mus musculus OX=10090 GN=Erp29 PE=1 SV=2
3	PDB:2qc7A	0.829	0.963	8.282E-35	224	0.854	0.996	2qc7A.pdb.gz
4	AFDB:O44342	0.692	0.702	4.616E-18	257	0.287	0.292	O44342.pdb.gz	WBL_DROME Protein windbeutel OS=Drosophila melanogaster OX=7227 GN=wbl PE=1 SV=1
5	PDB:1ovnA	0.717	0.807	1.538E-16	229	0.261	0.297	1ovnA.pdb.gz
6	AFDB:Q86IA3	0.460	0.361	4.241E-15	363	0.234	0.168	Q86IA3.pdb.gz	PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum OX=44689 GN=pdi1 PE=1 SV=2
7	AFDB:O13811	0.424	0.333	8.992E-13	359	0.176	0.128	O13811.pdb.gz	PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17H9.14c PE=3 SV=1
8	AFDB:Q57WS0	0.415	0.322	9.514E-13	377	0.230	0.159	Q57WS0.pdb.gz	Q57WS0_TRYB2 Protein disulfide isomerase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.560 PE=3 SV=1
9	AFDB:O22263	0.462	0.364	1.127E-12	361	0.192	0.139	O22263.pdb.gz	PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-1 PE=2 SV=1
10	AFDB:Q00216	0.457	0.363	1.786E-11	359	0.192	0.139	Q00216.pdb.gz	TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger OX=5061 GN=tigA PE=2 SV=1
11	AFDB:P17967	0.377	0.194	1.321E-7	522	0.126	0.063	P17967.pdb.gz	PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDI1 PE=1 SV=2
12	AFDB:I3L514	0.379	0.219	2.075E-7	463	0.130	0.073	I3L514.pdb.gz	I3L514_HUMAN protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=2
13	PDB:4ekzA	0.387	0.221	4.615E-7	469	0.119	0.066	4ekzA.pdb.gz
14	PDB:2l4qA	0.354	0.734	2.529E-5	116	0.115	0.259	2l4qA.pdb.gz
15	PDB:5gu6A	0.346	0.245	3.169E-5	377	0.088	0.061	5gu6A.pdb.gz
16	PDB:3qouA	0.363	0.338	6.596E-5	282	0.111	0.103	3qouA.pdb.gz	Escherichia coli Thioredoxin-like Protein YbbN Contains an Atypical Tetratricopeptide Repeat Motif and Is a Negative Regulator of GroEL.
17	PDB:4j56E	0.351	0.790	6.596E-5	105	0.077	0.190	4j56E.pdb.gz	Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
18	PDB:7scdA	0.353	0.254	6.978E-5	371	0.115	0.081	7scdA.pdb.gz	Structural and Substrate Specificity Analysis of 3-O-Sulfotransferase Isoform 5 to Synthesize Heparan Sulfate
19	PDB:2r2jA	0.321	0.260	9.251E-5	328	0.084	0.067	2r2jA.pdb.gz
20	PDB:4f9zA	0.340	0.397	9.251E-5	219	0.088	0.105	4f9zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30040	0.0	528	261	1.000	1.000	ERP29_HUMAN Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4
2	P52555	1.95e-160	447	260	0.900	0.904	ERP29_RAT Endoplasmic reticulum resident protein 29 OS=Rattus norvegicus OX=10116 GN=Erp29 PE=1 SV=2
3	P57759	1.84e-156	437	262	0.824	0.821	ERP29_MOUSE Endoplasmic reticulum resident protein 29 OS=Mus musculus OX=10090 GN=Erp29 PE=1 SV=2
4	O44342	6.06e-31	117	257	0.310	0.315	WBL_DROME Protein windbeutel OS=Drosophila melanogaster OX=7227 GN=wbl PE=1 SV=1
5	Q57WS0	4.24e-09	58.5	377	0.195	0.135	Q57WS0_TRYB2 Protein disulfide isomerase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.560 PE=3 SV=1
6	O13811	5.55e-07	52.0	359	0.138	0.100	PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17H9.14c PE=3 SV=1
7	O22263	1.00e-05	48.5	361	0.119	0.086	PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-1 PE=2 SV=1
8	A0A1S0S010	1.54e-04	45.1	503	0.157	0.082	A0A1S0S010_BRUMA Protein disulfide-isomerase OS=Brugia malayi OX=6279 GN=Bma-pdi-2 PE=2 SV=1
9	Q17967	0.055	37.0	485	0.146	0.078	PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans OX=6239 GN=pdi-1 PE=3 SV=1
10	Q9V076	0.14	35.8	451	0.184	0.106	RNJ_PYRAB Ribonuclease J OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=rnj PE=1 SV=1
11	I3L514	0.56	33.9	463	0.115	0.065	I3L514_HUMAN protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=2
12	I3L4M2	0.63	33.9	537	0.115	0.056	I3L4M2_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=2
13	F1R5N6	1.2	33.1	718	0.046	0.017	F1R5N6_DANRE B-cell lymphoma 6 protein isoform X2 OS=Danio rerio OX=7955 GN=bcl6 PE=4 SV=1
14	Q6PC08	1.2	33.1	704	0.046	0.017	Q6PC08_DANRE B-cell CLL/lymphoma 6 (Zinc finger protein 51) OS=Danio rerio OX=7955 GN=bcl6 PE=2 SV=1
15	A0A024R8S5	1.3	32.7	508	0.115	0.059	A0A024R8S5_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 PE=2 SV=1
16	P07237	1.3	32.7	508	0.115	0.059	PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3
17	Q2HWU2	1.4	32.7	510	0.115	0.059	PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata OX=9543 GN=P4HB PE=2 SV=1
18	Q13087	1.5	32.7	525	0.057	0.029	PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens OX=9606 GN=PDIA2 PE=1 SV=2
19	Q43116	1.6	32.3	498	0.126	0.066	PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis OX=3988 PE=2 SV=1
20	I3L3P5	2.6	32.0	472	0.050	0.028	I3L3P5_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07749 ERp29	1.7e-20	85.0	Endoplasmic reticulum protein ERp29, C-terminal domain
2	PF07912 ERp29_N	9.5e-53	189.1	ERp29, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261735

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282561	0.902	Gap junction alpha-1 protein
2	9606.ENSP00000247461	0.895	Calnexin
3	9606.ENSP00000327801	0.805	Protein disulfide-isomerase
4	9606.ENSP00000324173	0.797	78 kDa glucose-regulated protein
5	9606.ENSP00000300289	0.796	Protein disulfide-isomerase A3
6	9606.ENSP00000320866	0.781	Calreticulin
7	9606.ENSP00000308032	0.770	Cytochrome P450 2S1
8	9606.ENSP00000333534	0.731	Cytochrome P450 2F1
9	9606.ENSP00000379042	0.717	ERO1-like protein alpha
10	9606.ENSP00000286091	0.702	Protein disulfide-isomerase A4
11	9606.ENSP00000318147	0.686	ER degradation-enhancing alpha-mannosidase-like protein 3
12	9606.ENSP00000262455	0.682	Endoplasmic reticulum resident protein 44
13	9606.ENSP00000220616	0.676	Thyroglobulin
14	9606.ENSP00000351646	0.676	Stress-induced-phosphoprotein 1
15	9606.ENSP00000346635	0.661	ERO1-like protein beta
16	9606.ENSP00000369538	0.660	Rab GDP dissociation inhibitor beta
17	9606.ENSP00000299767	0.658	Endoplasmin
18	9606.ENSP00000302843	0.647	DnaJ heat shock protein family member C18
19	9606.ENSP00000394071	0.634	Rab GDP dissociation inhibitor alpha
20	9606.ENSP00000299608	0.628	Protein disulfide-isomerase TMX3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.813	identical protein binding
GO:0046983	0.512	protein dimerization activity
GO:0042803	0.431	protein homodimerization activity
GO:0003824	0.325	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050789	0.988	regulation of biological process
GO:0050794	0.976	regulation of cellular process
GO:0009987	0.923	cellular process
GO:1902531	0.915	regulation of intracellular signal transduction
GO:0019222	0.813	regulation of metabolic process
GO:0060255	0.791	regulation of macromolecule metabolic process
GO:0048519	0.788	negative regulation of biological process
GO:0048522	0.780	positive regulation of cellular process
GO:0051171	0.770	regulation of nitrogen compound metabolic process
GO:0080090	0.769	regulation of primary metabolic process
GO:0031323	0.748	regulation of cellular metabolic process
GO:0051246	0.653	regulation of protein metabolic process
GO:0019220	0.618	regulation of phosphate metabolic process
GO:0048523	0.605	negative regulation of cellular process
GO:0042325	0.571	regulation of phosphorylation
GO:0031399	0.565	regulation of protein modification process
GO:0048584	0.518	positive regulation of response to stimulus
GO:0010647	0.508	positive regulation of cell communication
GO:0023056	0.507	positive regulation of signaling
GO:0009893	0.503	positive regulation of metabolic process
GO:0032879	0.495	regulation of localization
GO:0065009	0.470	regulation of molecular function
GO:0006457	0.423	protein folding
GO:0050896	0.419	response to stimulus
GO:0010604	0.418	positive regulation of macromolecule metabolic process
GO:0051179	0.414	localization
GO:0060341	0.396	regulation of cellular localization
GO:0080135	0.366	regulation of cellular response to stress
GO:0001932	0.364	regulation of protein phosphorylation
GO:0051338	0.361	regulation of transferase activity
GO:0008152	0.343	metabolic process
GO:0051641	0.343	cellular localization
GO:0071704	0.332	organic substance metabolic process
GO:0009967	0.329	positive regulation of signal transduction
GO:0006810	0.320	transport
GO:0045859	0.319	regulation of protein kinase activity
GO:0008104	0.310	protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.980	membrane
GO:0070013	0.964	intracellular organelle lumen
GO:0031982	0.822	vesicle
GO:0005788	0.715	endoplasmic reticulum lumen
GO:0009986	0.713	cell surface
GO:0031410	0.621	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]