StarFunc result for job id P30044

User Input

>input (214 residues)
MGLAGVCALRRSAGYILVGGAGGQSAAAAARRYSEGEWASGGVRSFSRAAAAMAPIKVGD
AIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGV
QVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKR
FSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30044	1.000	1.000	4.702E-45	214	1.000	1.000	P30044.pdb.gz	PRDX5_HUMAN Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 PE=1 SV=4
2	AFDB:Q9R063	0.788	0.792	7.992E-38	213	0.780	0.784	Q9R063.pdb.gz	PRDX5_RAT Peroxiredoxin-5, mitochondrial OS=Rattus norvegicus OX=10116 GN=Prdx5 PE=1 SV=1
3	AFDB:F1QCE3	0.801	0.901	2.922E-29	190	0.472	0.532	F1QCE3.pdb.gz
4	AFDB:Q960M4	0.728	0.818	2.036E-27	190	0.453	0.511	Q960M4.pdb.gz	Q960M4_DROME Peroxiredoxin-5 OS=Drosophila melanogaster OX=7227 GN=Prx5 PE=1 SV=1
5	AFDB:Q949U7	0.691	0.633	1.387E-20	234	0.336	0.308	Q949U7.pdb.gz	PRX2E_ARATH Peroxiredoxin-2E, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PRXIIE PE=1 SV=2
6	AFDB:Q54N76	0.712	0.879	1.580E-20	172	0.318	0.395	Q54N76.pdb.gz	Q54N76_DICDI Thioredoxin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=prdx5 PE=3 SV=1
7	AFDB:O22711	0.700	0.917	1.629E-18	162	0.299	0.395	O22711.pdb.gz	PRX2D_ARATH Peroxiredoxin-2D OS=Arabidopsis thaliana OX=3702 GN=PRXIID PE=2 SV=2
8	AFDB:Q9M7T0	0.729	0.775	2.410E-18	201	0.266	0.284	Q9M7T0.pdb.gz	PRX2F_ARATH Peroxiredoxin-2F, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PRXIIF PE=1 SV=2
9	AFDB:Q7DDK4	0.677	0.594	1.063E-16	245	0.276	0.241	Q7DDK4.pdb.gz	Q7DDK4_NEIMB Peroxiredoxin 2 family protein/glutaredoxin OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=NMB0946 PE=4 SV=1
10	AFDB:P73728	0.653	0.736	1.293E-16	189	0.280	0.317	P73728.pdb.gz	PRX5_SYNY3 Peroxiredoxin sll1621 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1621 PE=1 SV=1
11	PDB:5j9cB	0.645	0.805	1.997E-15	170	0.248	0.312	5j9cB.pdb.gz
12	PDB:4h86A	0.647	0.734	6.668E-13	187	0.210	0.241	4h86A.pdb.gz
13	PDB:5b6mF	0.585	0.564	5.553E-10	223	0.145	0.139	5b6mF.pdb.gz
14	PDB:2z9sA	0.565	0.610	1.067E-9	197	0.159	0.173	2z9sA.pdb.gz
15	PDB:6iu1P	0.551	0.548	1.298E-9	215	0.182	0.181	6iu1P.pdb.gz
16	PDB:5b8aH	0.577	0.688	1.685E-9	177	0.173	0.209	5b8aH.pdb.gz
17	PDB:1qmvA	0.563	0.608	1.920E-9	197	0.168	0.183	1qmvA.pdb.gz
18	PDB:3sbcB	0.567	0.610	2.187E-9	197	0.159	0.173	3sbcB.pdb.gz
19	PDB:4k1fA	0.565	0.606	2.493E-9	198	0.145	0.157	4k1fA.pdb.gz
20	PDB:2bmxB	0.571	0.674	5.456E-9	178	0.131	0.157	2bmxB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30044	2.48e-154	427	214	1.000	1.000	PRDX5_HUMAN Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 PE=1 SV=4
2	Q9R063	1.24e-104	302	213	0.776	0.779	PRDX5_RAT Peroxiredoxin-5, mitochondrial OS=Rattus norvegicus OX=10116 GN=Prdx5 PE=1 SV=1
3	P99029	5.91e-103	298	210	0.734	0.748	PRDX5_MOUSE Peroxiredoxin-5, mitochondrial OS=Mus musculus OX=10090 GN=Prdx5 PE=1 SV=2
4	Q502C8	5.43e-70	212	162	0.458	0.605	Q502C8_DANRE Peroxiredoxin-5 OS=Danio rerio OX=7955 GN=zgc:112318 PE=1 SV=1
5	Q960M4	1.20e-63	197	190	0.453	0.511	Q960M4_DROME Peroxiredoxin-5 OS=Drosophila melanogaster OX=7227 GN=Prx5 PE=1 SV=1
6	Q949U7	2.35e-32	119	234	0.332	0.303	PRX2E_ARATH Peroxiredoxin-2E, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PRXIIE PE=1 SV=2
7	Q9XEX2	1.10e-31	115	162	0.322	0.426	PRX2B_ARATH Peroxiredoxin-2B OS=Arabidopsis thaliana OX=3702 GN=PRXIIB PE=1 SV=1
8	O22711	2.16e-31	114	162	0.313	0.414	PRX2D_ARATH Peroxiredoxin-2D OS=Arabidopsis thaliana OX=3702 GN=PRXIID PE=2 SV=2
9	Q54N76	6.32e-31	113	172	0.313	0.390	Q54N76_DICDI Thioredoxin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=prdx5 PE=3 SV=1
10	Q9SRZ4	1.26e-30	112	162	0.313	0.414	PRX2C_ARATH Peroxiredoxin-2C OS=Arabidopsis thaliana OX=3702 GN=PRXIIC PE=1 SV=1
11	P73728	1.15e-26	102	189	0.266	0.302	PRX5_SYNY3 Peroxiredoxin sll1621 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1621 PE=1 SV=1
12	Q7DDK4	6.01e-25	100	245	0.266	0.233	Q7DDK4_NEIMB Peroxiredoxin 2 family protein/glutaredoxin OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=NMB0946 PE=4 SV=1
13	O43099	9.58e-25	97.4	168	0.262	0.333	PRX5_ASPFU Peroxiredoxin Asp f3 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=aspf3 PE=1 SV=1
14	Q9M7T0	2.77e-24	97.1	201	0.248	0.264	PRX2F_ARATH Peroxiredoxin-2F, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PRXIIF PE=1 SV=2
15	Q5ASN8	8.00e-24	95.1	168	0.280	0.357	PRX5_EMENI Putative peroxiredoxin prxA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=prxA PE=1 SV=1
16	A2R6R3	2.72e-22	90.9	166	0.266	0.343	A2R6R3_ASPNC Contig An16c0020, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An16g00920 PE=3 SV=1
17	A2R0G9	2.16e-20	85.9	168	0.252	0.321	A2R0G9_ASPNC Contig An12c0290, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An12g08570 PE=3 SV=1
18	O14313	5.88e-20	84.7	156	0.252	0.346	PMP20_SCHPO Peroxisomal membrane associated protein 20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pmp20 PE=1 SV=2
19	Q5MYR6	2.70e-17	79.3	240	0.229	0.204	Q5MYR6_PLAF7 1-cys peroxiredoxin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=prx PE=1 SV=1
20	Q5AF44	2.52e-16	75.5	176	0.206	0.250	Q5AF44_CANAL Thioredoxin peroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=AHP1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00578 AhpC-TSA	3e-10	51.5	AhpC/TSA family
2	PF13460 NAD_binding_10	14	17.1	NAD(P)H-binding
3	PF08534 Redoxin	1.9e-27	107.2	Redoxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265462

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363641	0.984	Thioredoxin
2	9606.ENSP00000216185	0.983	Thioredoxin, mitochondrial
3	9606.ENSP00000262746	0.983	Peroxiredoxin-1
4	9606.ENSP00000301522	0.983	Peroxiredoxin-2
5	9606.ENSP00000298510	0.951	Thioredoxin-dependent peroxide reductase, mitochondrial
6	9606.ENSP00000241052	0.929	Catalase
7	9606.ENSP00000342026	0.922	Peroxiredoxin-6
8	9606.ENSP00000418770	0.894	Protein/nucleic acid deglycase DJ-1
9	9606.ENSP00000446252	0.890	Superoxide dismutase [Mn], mitochondrial
10	9606.ENSP00000270142	0.865	Superoxide dismutase [Cu-Zn]
11	9606.ENSP00000368646	0.859	Peroxiredoxin-4
12	9606.ENSP00000434516	0.831	Thioredoxin reductase 1, cytoplasmic
13	9606.ENSP00000221130	0.823	Glutathione reductase, mitochondrial
14	9606.ENSP00000371388	0.788	Sulfiredoxin-1
15	9606.ENSP00000412922	0.725	Ubiquitin-related modifier 1
16	9606.ENSP00000369314	0.719	Glutaredoxin-1
17	9606.ENSP00000337060	0.712	Nucleoside diphosphate kinase A
18	9606.ENSP00000377696	0.706	Omega-amidase NIT2
19	9606.ENSP00000407375	0.700	Glutathione peroxidase 1
20	9606.ENSP00000346103	0.696	Phospholipid hydroperoxide glutathione peroxidase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008379	0.995	thioredoxin peroxidase activity
GO:0042802	0.962	identical protein binding
GO:0097159	0.769	organic cyclic compound binding
GO:1901363	0.744	heterocyclic compound binding
GO:0061134	0.600	peptidase regulator activity
GO:0004857	0.599	enzyme inhibitor activity
GO:0061135	0.571	endopeptidase regulator activity
GO:0030414	0.563	peptidase inhibitor activity
GO:0003676	0.507	nucleic acid binding
GO:0004866	0.471	endopeptidase inhibitor activity
GO:0043028	0.440	cysteine-type endopeptidase regulator activity involved in apoptotic process
GO:0004869	0.428	cysteine-type endopeptidase inhibitor activity
GO:0003690	0.397	double-stranded DNA binding
GO:1990837	0.385	sequence-specific double-stranded DNA binding
GO:0001016	0.330	RNA polymerase III transcription regulatory region sequence-specific DNA binding
GO:0043027	0.318	cysteine-type endopeptidase inhibitor activity involved in apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.991	cellular metabolic process
GO:0071704	0.989	organic substance metabolic process
GO:0050896	0.972	response to stimulus
GO:0042743	0.954	hydrogen peroxide metabolic process
GO:0044248	0.948	cellular catabolic process
GO:0044238	0.909	primary metabolic process
GO:0006950	0.901	response to stress
GO:0042744	0.876	hydrogen peroxide catabolic process
GO:0065007	0.732	biological regulation
GO:0006979	0.724	response to oxidative stress
GO:0050789	0.672	regulation of biological process
GO:0006807	0.663	nitrogen compound metabolic process
GO:0050794	0.655	regulation of cellular process
GO:0048519	0.635	negative regulation of biological process
GO:0010941	0.588	regulation of cell death
GO:1901564	0.581	organonitrogen compound metabolic process
GO:0048523	0.522	negative regulation of cellular process
GO:0051716	0.493	cellular response to stimulus
GO:0044281	0.492	small molecule metabolic process
GO:0042221	0.472	response to chemical
GO:0006796	0.470	phosphate-containing compound metabolic process
GO:0019222	0.456	regulation of metabolic process
GO:0034641	0.406	cellular nitrogen compound metabolic process
GO:0043067	0.405	regulation of programmed cell death
GO:0042981	0.403	regulation of apoptotic process
GO:0019637	0.400	organophosphate metabolic process
GO:1901360	0.396	organic cyclic compound metabolic process
GO:0046483	0.396	heterocycle metabolic process
GO:0033554	0.394	cellular response to stress
GO:0006725	0.389	cellular aromatic compound metabolic process
GO:0070887	0.375	cellular response to chemical stimulus
GO:0006139	0.344	nucleobase-containing compound metabolic process
GO:0060548	0.340	negative regulation of cell death
GO:0043066	0.313	negative regulation of apoptotic process
GO:0055086	0.306	nucleobase-containing small molecule metabolic process
GO:0031323	0.304	regulation of cellular metabolic process
GO:0009117	0.304	nucleotide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.994	intracellular organelle lumen
GO:0005576	0.973	extracellular region
GO:0005829	0.939	cytosol
GO:0031982	0.919	vesicle
GO:0005615	0.876	extracellular space
GO:0070062	0.859	extracellular exosome
GO:0005634	0.818	nucleus
GO:0042579	0.776	microbody
GO:0005777	0.769	peroxisome
GO:0005759	0.586	mitochondrial matrix
GO:0031981	0.482	nuclear lumen
GO:0012505	0.363	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:63528	0.995	[thioredoxin]-dithiol + H2O2 = [thioredoxin]-disulfide + 2 H2O

[back to server]