StarFunc result for job id P30046

User Input

>input (118 residues)
MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQL
SISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30046	1.000	1.000	1.667E-27	118	1.000	1.000	P30046.pdb.gz	DOPD_HUMAN D-dopachrome decarboxylase OS=Homo sapiens OX=9606 GN=DDT PE=1 SV=3
2	PDB:7mw7A	0.992	0.992	3.929E-25	118	0.992	0.992	7mw7A.pdb.gz
3	AFDB:O35215	0.996	0.996	4.197E-23	118	0.737	0.737	O35215.pdb.gz	DOPD_MOUSE D-dopachrome decarboxylase OS=Mus musculus OX=10090 GN=Ddt PE=1 SV=3
4	PDB:3kerA	0.975	0.983	5.470E-21	117	0.720	0.726	3kerA.pdb.gz	Targeting distinct tautomerase sites of D-DT and MIF with a single molecule for inhibition of neutrophil lung recruitment.
5	AFDB:F1QJV7	0.965	0.965	3.231E-19	118	0.534	0.534	F1QJV7.pdb.gz
6	AFDB:A6NHG4	0.777	0.686	3.454E-17	134	0.797	0.701	A6NHG4.pdb.gz	DDTL_HUMAN D-dopachrome decarboxylase-like protein OS=Homo sapiens OX=9606 GN=DDTL PE=2 SV=1
7	AFDB:A4GRE3	0.946	0.938	2.329E-15	119	0.322	0.319	A4GRE3.pdb.gz	A4GRE3_9BILA Macrophage migration inhibitory factor OS=Ancylostoma ceylanicum OX=53326 PE=1 SV=1
8	PDB:2os5A	0.924	0.924	4.217E-14	118	0.305	0.305	2os5A.pdb.gz
9	AFDB:P34884	0.912	0.935	1.059E-13	115	0.331	0.339	P34884.pdb.gz	MIF_MOUSE Macrophage migration inhibitory factor OS=Mus musculus OX=10090 GN=Mif PE=1 SV=2
10	AFDB:I4AY87	0.912	0.935	1.571E-13	115	0.339	0.348	I4AY87.pdb.gz	I4AY87_HUMAN Epididymis secretory sperm binding protein (Fragment) OS=Homo sapiens OX=9606 GN=MIF PE=2 SV=1
11	AFDB:Q02960	0.916	0.939	3.033E-13	115	0.305	0.313	Q02960.pdb.gz	MIF_CHICK Macrophage migration inhibitory factor OS=Gallus gallus OX=9031 GN=MIF PE=3 SV=3
12	PDB:1gczA	0.895	0.895	4.219E-13	118	0.322	0.322	1gczA.pdb.gz	Coumarin and chromen-4-one analogues as tautomerase inhibitors of macrophage migration inhibitory factor: discovery and X-ray crystallography.
13	AFDB:P90835	0.883	0.720	1.679E-12	146	0.280	0.226	P90835.pdb.gz	MIF3_CAEEL MIF-like protein mif-3 OS=Caenorhabditis elegans OX=6239 GN=mif-3 PE=3 SV=1
14	AFDB:Q0ZBR7	0.908	0.930	1.915E-12	115	0.288	0.296	Q0ZBR7.pdb.gz	Q0ZBR7_DANRE Macrophage migration inhibitory factor OS=Danio rerio OX=7955 GN=MIF PE=1 SV=1
15	PDB:1mfiA	0.888	0.917	3.037E-12	114	0.297	0.307	1mfiA.pdb.gz	Crystal structure of macrophage migration inhibitory factor complexed with (E)-2-fluoro-p-hydroxycinnamate at 1.8 A resolution: implications for enzymatic catalysis and inhibition.
16	PDB:2wkfB	0.638	0.716	3.709E-7	103	0.161	0.184	2wkfB.pdb.gz
17	PDB:5hp5A	0.208	0.051	1.138E-1	669	0.102	0.018	5hp5A.pdb.gz	Monomeric Form of Peptidylarginine Deiminase Type I Revealed by X-ray Crystallography and Small-Angle X-ray Scattering
18	PDB:2opaA	0.392	0.709	1.386E-1	61	0.059	0.115	2opaA.pdb.gz	The Crystal Structure of YwhB, a 4-Oxalocrotonate Tautomerase Homologue from Bacillus subtilis: the Structural Basis for Catalysis, Inhibition, and Reaction Stereoselectivity.
19	PDB:2d2zB	0.219	0.143	1.926E-1	240	0.136	0.067	2d2zB.pdb.gz
20	PDB:3esjA	0.327	0.249	1.926E-1	162	0.102	0.074	3esjA.pdb.gz	A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30046	8.74e-84	241	118	1.000	1.000	DOPD_HUMAN D-dopachrome decarboxylase OS=Homo sapiens OX=9606 GN=DDT PE=1 SV=3
2	A6NHG4	2.14e-64	193	134	0.805	0.709	DDTL_HUMAN D-dopachrome decarboxylase-like protein OS=Homo sapiens OX=9606 GN=DDTL PE=2 SV=1
3	O35215	9.95e-64	191	118	0.737	0.737	DOPD_MOUSE D-dopachrome decarboxylase OS=Mus musculus OX=10090 GN=Ddt PE=1 SV=3
4	P80254	1.72e-63	190	118	0.746	0.746	DOPD_RAT D-dopachrome decarboxylase OS=Rattus norvegicus OX=10116 GN=Ddt PE=1 SV=3
5	Q6IQL4	6.55e-44	141	118	0.534	0.534	Q6IQL4_DANRE D-dopachrome decarboxylase OS=Danio rerio OX=7955 GN=zgc:86714 PE=1 SV=1
6	P30904	7.30e-18	75.1	115	0.331	0.339	MIF_RAT Macrophage migration inhibitory factor OS=Rattus norvegicus OX=10116 GN=Mif PE=1 SV=4
7	I4AY87	9.07e-18	74.7	115	0.339	0.348	I4AY87_HUMAN Epididymis secretory sperm binding protein (Fragment) OS=Homo sapiens OX=9606 GN=MIF PE=2 SV=1
8	P14174	9.07e-18	74.7	115	0.339	0.348	MIF_HUMAN Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4
9	P34884	9.89e-18	74.7	115	0.331	0.339	MIF_MOUSE Macrophage migration inhibitory factor OS=Mus musculus OX=10090 GN=Mif PE=1 SV=2
10	A4GRE3	2.33e-17	73.6	119	0.322	0.319	A4GRE3_9BILA Macrophage migration inhibitory factor OS=Ancylostoma ceylanicum OX=53326 PE=1 SV=1
11	Q02960	6.30e-17	72.4	115	0.305	0.313	MIF_CHICK Macrophage migration inhibitory factor OS=Gallus gallus OX=9031 GN=MIF PE=3 SV=3
12	Q0ZBR7	3.95e-14	65.5	115	0.297	0.304	Q0ZBR7_DANRE Macrophage migration inhibitory factor OS=Danio rerio OX=7955 GN=MIF PE=1 SV=1
13	F4KAK0	7.15e-09	51.6	116	0.280	0.284	F4KAK0_ARATH Tautomerase/MIF superfamily protein OS=Arabidopsis thaliana OX=3702 GN=MUL3.12 PE=1 SV=1
14	P90835	3.58e-08	50.4	146	0.288	0.233	MIF3_CAEEL MIF-like protein mif-3 OS=Caenorhabditis elegans OX=6239 GN=mif-3 PE=3 SV=1
15	F4K9G5	1.94e-06	45.4	122	0.246	0.238	F4K9G5_ARATH Tautomerase/MIF superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g01650 PE=1 SV=1
16	Q8LG92	0.009	35.4	112	0.229	0.241	Q8LG92_ARATH LS1-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g51660 PE=1 SV=1
17	O94679	3.9	29.3	1158	0.153	0.016	CND1_SCHPO Condensin complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnd1 PE=1 SV=1
18	F4J1H7	4.1	29.3	942	0.136	0.017	RNZ4_ARATH tRNAse Z TRZ4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=TRZ4 PE=2 SV=1
19	Q8WWZ7	6.3	28.5	1642	0.246	0.018	ABCA5_HUMAN Cholesterol transporter ABCA5 OS=Homo sapiens OX=9606 GN=ABCA5 PE=1 SV=2
20	Q5AWD9	8.3	28.1	544	0.169	0.037	Q5AWD9_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07391 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01187 MIF	2e-48	174.8	Macrophage migration inhibitory factor (MIF)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381386

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000009530	0.978	HLA class II histocompatibility antigen gamma chain
2	9606.ENSP00000319635	0.891	C-X-C chemokine receptor type 2
3	9606.ENSP00000385828	0.697	Thiosulfate sulfurtransferase
4	9606.ENSP00000350512	0.642	COP9 signalosome complex subunit 5
5	9606.ENSP00000424077	0.614	Putative ubiquitin carboxyl-terminal hydrolase 17-like protein 23
6	9606.ENSP00000262746	0.579	Peroxiredoxin-1
7	9606.ENSP00000392762	0.572	L-dopachrome tautomerase
8	9606.ENSP00000386884	0.560	C-X-C chemokine receptor type 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005126	0.999	cytokine receptor binding
GO:0016863	0.998	intramolecular oxidoreductase activity, transposing C=C bonds
GO:0016830	0.995	carbon-carbon lyase activity
GO:0016831	0.994	carboxy-lyase activity
GO:0004167	0.613	dopachrome isomerase activity
GO:0002020	0.501	protease binding
GO:0033981	0.441	D-dopachrome decarboxylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0050727	0.980	regulation of inflammatory response
GO:0048518	0.968	positive regulation of biological process
GO:0009893	0.949	positive regulation of metabolic process
GO:0048519	0.946	negative regulation of biological process
GO:0023051	0.922	regulation of signaling
GO:0010646	0.922	regulation of cell communication
GO:0010468	0.920	regulation of gene expression
GO:0010604	0.920	positive regulation of macromolecule metabolic process
GO:0040012	0.898	regulation of locomotion
GO:0048584	0.886	positive regulation of response to stimulus
GO:0002682	0.884	regulation of immune system process
GO:0048523	0.880	negative regulation of cellular process
GO:0001817	0.878	regulation of cytokine production
GO:0010628	0.878	positive regulation of gene expression
GO:0048522	0.833	positive regulation of cellular process
GO:0009966	0.739	regulation of signal transduction
GO:0001819	0.736	positive regulation of cytokine production
GO:1902531	0.720	regulation of intracellular signal transduction
GO:2000145	0.637	regulation of cell motility
GO:0030334	0.627	regulation of cell migration
GO:0050729	0.577	positive regulation of inflammatory response
GO:0043408	0.561	regulation of MAPK cascade
GO:0043410	0.540	positive regulation of MAPK cascade
GO:0048585	0.532	negative regulation of response to stimulus
GO:0050896	0.480	response to stimulus
GO:0009987	0.453	cellular process
GO:1903555	0.438	regulation of tumor necrosis factor superfamily cytokine production
GO:0070374	0.389	positive regulation of ERK1 and ERK2 cascade
GO:0040013	0.335	negative regulation of locomotion
GO:2000146	0.323	negative regulation of cell motility

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0005737	0.999	cytoplasm
GO:0031982	0.998	vesicle
GO:0070062	0.978	extracellular exosome
GO:0043231	0.854	intracellular membrane-bounded organelle
GO:0031410	0.674	cytoplasmic vesicle
GO:0016020	0.471	membrane
GO:0012505	0.426	endomembrane system
GO:0070013	0.416	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.3.3.-	0.998	Transposing C=C bonds.
EC:4.1.-.-	0.995	Carbon-carbon lyases.
EC:4.1.1.-	0.994	Carboxy-lyases.
RHEA:13041	0.613	L-dopachrome = 5,6-dihydroxyindole-2-carboxylate
EC:5.3.3.12	0.613	L-dopachrome isomerase.
RHEA:18441	0.441	D-dopachrome + H(+) = 5,6-dihydroxyindole + CO2
EC:4.1.1.84	0.441	D-dopachrome decarboxylase.

[back to server]