StarFunc result for job id P30049

User Input

>input (168 residues)
MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDV
PTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAV
TLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05630	0.859	0.859	2.545E-30	168	0.911	0.911	P05630.pdb.gz	ATPD_BOVIN ATP synthase subunit delta, mitochondrial OS=Bos taurus OX=9913 GN=ATP5F1D PE=1 SV=2
2	AFDB:P35434	0.828	0.828	3.435E-30	168	0.869	0.869	P35434.pdb.gz	ATPD_RAT ATP synthase subunit delta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5f1d PE=1 SV=2
3	PDB:2w6hH	0.769	0.984	6.437E-24	131	0.738	0.947	2w6hH.pdb.gz
4	AFDB:Q09544	0.780	0.804	6.764E-21	163	0.470	0.485	Q09544.pdb.gz	ATPD_CAEEL ATP synthase subunit delta, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=F58F12.1 PE=1 SV=1
5	AFDB:Q9W2X6	0.780	0.834	3.214E-20	157	0.440	0.471	Q9W2X6.pdb.gz	Q9W2X6_DROME ATP synthase, delta subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=ATPsyndelta PE=1 SV=1
6	AFDB:Q9P6R6	0.781	0.786	9.796E-19	167	0.315	0.317	Q9P6R6.pdb.gz	ATPD_SCHPO ATP synthase subunit delta, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp16 PE=3 SV=2
7	AFDB:C6GFP2	0.792	0.668	7.985E-18	200	0.357	0.300	C6GFP2.pdb.gz	C6GFP2_GOSHI ATP synthase delta subunit 1 OS=Gossypium hirsutum OX=3635 GN=LOC107950798 PE=2 SV=1
8	AFDB:Q12165	0.749	0.785	2.494E-17	160	0.321	0.338	Q12165.pdb.gz	ATPD_YEAST ATP synthase subunit delta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP16 PE=1 SV=1
9	AFDB:Q96252	0.769	0.639	2.494E-17	203	0.274	0.227	Q96252.pdb.gz	ATP4_ARATH ATP synthase subunit delta', mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g47030 PE=1 SV=1
10	AFDB:Q586H1	0.791	0.733	5.121E-17	182	0.286	0.264	Q586H1.pdb.gz	Q586H1_TRYB2 ATP synthase, epsilon chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.30P15.500 PE=1 SV=1
11	PDB:8ap9H	0.781	0.814	3.272E-16	161	0.262	0.273	8ap9H.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
12	AFDB:P0A6E6	0.727	0.871	1.198E-14	139	0.167	0.201	P0A6E6.pdb.gz	ATPE_ECOLI ATP synthase epsilon chain OS=Escherichia coli (strain K12) OX=83333 GN=atpC PE=1 SV=2
13	PDB:1bshA	0.661	0.787	7.111E-11	138	0.173	0.210	1bshA.pdb.gz
14	PDB:2xokH	0.639	0.882	1.970E-10	119	0.232	0.328	2xokH.pdb.gz	Molecular architecture of the rotary motor in ATP synthase.
15	PDB:5yioA	0.489	0.657	1.529E-7	121	0.167	0.231	5yioA.pdb.gz
16	PDB:2w6jH	0.469	0.938	1.405E-6	83	0.458	0.928	2w6jH.pdb.gz	Improving diffraction by humidity control: a novel device compatible with X-ray beamlines.
17	PDB:6asyA	0.200	0.074	1.400E-1	606	0.137	0.038	6asyA.pdb.gz	Conformation transitions of the polypeptide-binding pocket support an active substrate release from Hsp70s.
18	PDB:7rdqD	0.170	0.028	1.579E-1	1366	0.185	0.023	7rdqD.pdb.gz	Structural and mechanistic basis of reiterative transcription initiation.
19	PDB:3ik4B	0.142	0.078	2.708E-1	358	0.137	0.064	3ik4B.pdb.gz
20	PDB:3jb9D	0.151	0.228	2.708E-1	96	0.071	0.125	3jb9D.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30049	3.46e-118	332	168	1.000	1.000	ATPD_HUMAN ATP synthase subunit delta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1D PE=1 SV=2
2	P05630	5.86e-100	286	168	0.911	0.911	ATPD_BOVIN ATP synthase subunit delta, mitochondrial OS=Bos taurus OX=9913 GN=ATP5F1D PE=1 SV=2
3	P35434	1.54e-94	273	168	0.869	0.869	ATPD_RAT ATP synthase subunit delta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5f1d PE=1 SV=2
4	Q9D3D9	5.04e-93	269	168	0.863	0.863	ATPD_MOUSE ATP synthase subunit delta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1d PE=1 SV=1
5	Q9W2X6	6.24e-38	129	157	0.446	0.478	Q9W2X6_DROME ATP synthase, delta subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=ATPsyndelta PE=1 SV=1
6	Q09544	1.01e-36	126	163	0.393	0.405	ATPD_CAEEL ATP synthase subunit delta, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=F58F12.1 PE=1 SV=1
7	Q9P6R6	8.32e-21	85.9	167	0.327	0.329	ATPD_SCHPO ATP synthase subunit delta, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp16 PE=3 SV=2
8	C6GFP2	1.44e-19	83.2	200	0.304	0.255	C6GFP2_GOSHI ATP synthase delta subunit 1 OS=Gossypium hirsutum OX=3635 GN=LOC107950798 PE=2 SV=1
9	Q96252	4.80e-19	82.0	203	0.286	0.236	ATP4_ARATH ATP synthase subunit delta', mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g47030 PE=1 SV=1
10	Q12165	1.55e-14	69.3	160	0.268	0.281	ATPD_YEAST ATP synthase subunit delta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP16 PE=1 SV=1
11	Q586H1	3.13e-14	68.9	182	0.244	0.225	Q586H1_TRYB2 ATP synthase, epsilon chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.30P15.500 PE=1 SV=1
12	P0A6E6	0.002	38.9	139	0.185	0.223	ATPE_ECOLI ATP synthase epsilon chain OS=Escherichia coli (strain K12) OX=83333 GN=atpC PE=1 SV=2
13	Q8IHP4	0.003	38.5	154	0.083	0.091	Q8IHP4_PLAF7 ATP synthase subunit delta, mitochondrial, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1147700 PE=3 SV=1
14	P26533	0.036	35.4	136	0.179	0.221	ATPE_SYNY3 ATP synthase epsilon chain OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=atpC PE=1 SV=3
15	Q12809	0.92	32.3	1159	0.125	0.018	KCNH2_HUMAN Potassium voltage-gated channel subfamily H member 2 OS=Homo sapiens OX=9606 GN=KCNH2 PE=1 SV=1
16	O35219	1.0	32.0	1162	0.125	0.018	KCNH2_MOUSE Potassium voltage-gated channel subfamily H member 2 OS=Mus musculus OX=10090 GN=Kcnh2 PE=1 SV=2
17	O08962	1.1	32.0	1163	0.125	0.018	KCNH2_RAT Potassium voltage-gated channel subfamily H member 2 OS=Rattus norvegicus OX=10116 GN=Kcnh2 PE=1 SV=1
18	P09468	2.0	30.0	132	0.179	0.227	ATPE_ARATH ATP synthase epsilon chain, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=atpE PE=1 SV=2
19	Q7JPB9	2.7	30.8	855	0.077	0.015	Q7JPB9_DROME GH12235p OS=Drosophila melanogaster OX=7227 GN=sei PE=2 SV=1
20	P9WPV1	3.4	29.3	121	0.143	0.198	ATPE_MYCTU ATP synthase epsilon chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=atpC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02823 ATP-synt_DE_N	1.5e-12	58.6	ATP synthase, Delta/Epsilon chain, beta-sandwich domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000215375

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243997	0.999	ATP synthase subunit epsilon, mitochondrial
2	9606.ENSP00000262030	0.999	ATP synthase subunit beta, mitochondrial
3	9606.ENSP00000290299	0.999	ATP synthase subunit O, mitochondrial
4	9606.ENSP00000292475	0.999	ATP synthase subunit f, mitochondrial
5	9606.ENSP00000300688	0.999	ATP synthase subunit g, mitochondrial
6	9606.ENSP00000301587	0.999	ATP synthase subunit d, mitochondrial
7	9606.ENSP00000306003	0.999	ATP synthase subunit e, mitochondrial
8	9606.ENSP00000349142	0.999	ATP synthase subunit gamma, mitochondrial
9	9606.ENSP00000354632	0.999	ATP synthase subunit a
10	9606.ENSP00000358737	0.999	ATP synthase F(0) complex subunit B1, mitochondrial
11	9606.ENSP00000381736	0.999	ATP synthase subunit alpha, mitochondrial
12	9606.ENSP00000389649	0.999	ATP synthase-coupling factor 6, mitochondrial
13	9606.ENSP00000355265	0.997	ATP synthase protein 8
14	9606.ENSP00000358840	0.997	Up-regulated during skeletal muscle growth protein 5
15	9606.ENSP00000377033	0.996	ATP synthase F(0) complex subunit C1, mitochondrial
16	9606.ENSP00000327268	0.995	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
17	9606.ENSP00000233627	0.994	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
18	9606.ENSP00000356972	0.994	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
19	9606.ENSP00000394107	0.994	annotation not available
20	9606.ENSP00000203407	0.992	Cytochrome b-c1 complex subunit 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046933	0.998	proton-transporting ATP synthase activity, rotational mechanism
GO:0005488	0.997	binding
GO:0005515	0.605	protein binding
GO:0140657	0.573	ATP-dependent activity
GO:0016887	0.473	ATP hydrolysis activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0071704	0.996	organic substance metabolic process
GO:0072521	0.985	purine-containing compound metabolic process
GO:0009199	0.985	ribonucleoside triphosphate metabolic process
GO:0009144	0.985	purine nucleoside triphosphate metabolic process
GO:1901293	0.985	nucleoside phosphate biosynthetic process
GO:0006754	0.978	ATP biosynthetic process
GO:0015986	0.966	proton motive force-driven ATP synthesis
GO:0006091	0.509	generation of precursor metabolites and energy
GO:0071840	0.462	cellular component organization or biogenesis
GO:0016043	0.335	cellular component organization
GO:0009060	0.329	aerobic respiration
GO:0007005	0.320	mitochondrion organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.999	mitochondrial inner membrane
GO:1902494	0.997	catalytic complex
GO:0098796	0.997	membrane protein complex
GO:0098800	0.989	inner mitochondrial membrane protein complex
GO:0016469	0.959	proton-transporting two-sector ATPase complex
GO:0045259	0.937	proton-transporting ATP synthase complex
GO:0005753	0.905	mitochondrial proton-transporting ATP synthase complex
GO:0043233	0.890	organelle lumen
GO:0070013	0.870	intracellular organelle lumen
GO:0005759	0.423	mitochondrial matrix
GO:0031981	0.364	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:57720	0.998	ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate
EC:7.1.2.2	0.998	H(+)-transporting two-sector ATPase.
RHEA:13065	0.473	ATP + H2O = ADP + H(+) + phosphate

[back to server]