StarFunc result for job id P30084

User Input

>input (290 residues)
MAALRVLLSCVRGPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNA
LCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHW
DHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMA
KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30084	1.000	1.000	9.312E-57	290	1.000	1.000	P30084.pdb.gz	ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4
2	AFDB:P14604	0.924	0.924	7.640E-51	290	0.869	0.869	P14604.pdb.gz	ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Echs1 PE=1 SV=1
3	PDB:2hw5C	0.895	0.998	7.157E-48	260	0.893	0.996	2hw5C.pdb.gz	The crystal structure of human enoyl-coenzyme A (CoA) hydratase short chain 1, ECHS1
4	PDB:1dubA	0.894	0.997	2.218E-46	260	0.807	0.900	1dubA.pdb.gz	Crystal structure of enoyl-coenzyme A (CoA) hydratase at 2.5 angstroms resolution: a spiral fold defines the CoA-binding pocket.
5	AFDB:Q7JR58	0.896	0.881	6.542E-41	295	0.566	0.556	Q7JR58.pdb.gz	Q7JR58_DROME Enoyl-CoA hydratase, short chain 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Echs1 PE=1 SV=1
6	AFDB:P34559	0.895	0.901	2.414E-39	288	0.572	0.576	P34559.pdb.gz	ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ech-6 PE=3 SV=1
7	AFDB:P9WNN9	0.869	0.979	3.571E-35	257	0.448	0.506	P9WNN9.pdb.gz	ECHA8_MYCTU Probable enoyl-CoA hydratase EchA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA8 PE=1 SV=1
8	PDB:3h81A	0.867	0.981	4.662E-35	256	0.448	0.508	3h81A.pdb.gz	Increasing the structural coverage of tuberculosis drug targets.
9	AFDB:C8V3K8	0.888	0.891	9.605E-35	289	0.466	0.467	C8V3K8.pdb.gz	C8V3K8_EMENI Enoyl-CoA hydratase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05916 PE=3 SV=1
10	AFDB:P76082	0.859	0.975	4.083E-32	255	0.390	0.443	P76082.pdb.gz	PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) OX=83333 GN=paaF PE=1 SV=1
11	PDB:5zaiC	0.846	0.944	1.234E-30	259	0.407	0.456	5zaiC.pdb.gz	Structural Insight into Substrate Specificity of 3-Hydroxypropionyl-Coenzyme A Dehydratase from Metallosphaera sedula
12	PDB:4fzwB	0.860	0.972	3.953E-30	256	0.390	0.441	4fzwB.pdb.gz
13	AFDB:A4YI89	0.846	0.945	5.744E-30	259	0.407	0.456	A4YI89.pdb.gz	HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_2001 PE=1 SV=1
14	AFDB:F4JML5	0.828	0.798	1.146E-27	301	0.293	0.282	F4JML5.pdb.gz	ECH2M_ARATH Probable enoyl-CoA hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g16800 PE=2 SV=1
15	AFDB:A1Z934	0.827	0.803	2.504E-26	299	0.324	0.314	A1Z934.pdb.gz	A1Z934_DROME SD19268p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8778 PE=1 SV=1
16	PDB:4i42A	0.694	0.705	7.764E-24	285	0.279	0.284	4i42A.pdb.gz	Structural basis of the induced-fit mechanism of 1,4-dihydroxy-2-naphthoyl coenzyme A synthase from the crotonase fold superfamily
17	PDB:7oeqA	0.793	0.881	1.005E-22	259	0.283	0.317	7oeqA.pdb.gz
18	PDB:4fzwD	0.797	0.918	3.616E-22	250	0.276	0.320	4fzwD.pdb.gz
19	PDB:6wyiA	0.738	0.896	9.972E-21	237	0.266	0.325	6wyiA.pdb.gz
20	PDB:1jxzB	0.770	0.827	1.414E-20	269	0.252	0.271	1jxzB.pdb.gz	Histidine 90 Function in 4-chlorobenzoyl-coenzyme A Dehalogenase Catalysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P14604	0.0	522	290	0.869	0.869	ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Echs1 PE=1 SV=1
2	P30084	0.0	597	290	1.000	1.000	ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4
3	Q8BH95	0.0	521	290	0.876	0.876	ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Echs1 PE=1 SV=1
4	Q7JR58	2.55e-113	330	295	0.541	0.532	Q7JR58_DROME Enoyl-CoA hydratase, short chain 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Echs1 PE=1 SV=1
5	P34559	2.63e-110	322	288	0.545	0.549	ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ech-6 PE=3 SV=1
6	P9WNN9	6.38e-92	275	257	0.445	0.502	ECHA8_MYCTU Probable enoyl-CoA hydratase EchA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA8 PE=1 SV=1
7	C8V3K8	4.15e-87	263	289	0.466	0.467	C8V3K8_EMENI Enoyl-CoA hydratase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05916 PE=3 SV=1
8	P76082	2.75e-71	222	255	0.386	0.439	PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) OX=83333 GN=paaF PE=1 SV=1
9	A4YI89	9.33e-70	218	259	0.407	0.456	HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_2001 PE=1 SV=1
10	A1Z934	4.55e-42	148	299	0.331	0.321	A1Z934_DROME SD19268p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8778 PE=1 SV=1
11	F4JML5	5.97e-42	148	301	0.283	0.272	ECH2M_ARATH Probable enoyl-CoA hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g16800 PE=2 SV=1
12	Q4WF54	2.05e-38	138	270	0.286	0.307	SIDH_ASPFU Mevalonyl-coenzyme A hydratase sidH OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=sidH PE=1 SV=1
13	P31551	2.11e-38	137	261	0.290	0.322	CAID_ECOLI Carnitinyl-CoA dehydratase OS=Escherichia coli (strain K12) OX=83333 GN=caiD PE=1 SV=4
14	G4V4T7	1.28e-37	135	265	0.307	0.336	DPGD_AMYOR Enoyl-CoA-hydratase OS=Amycolatopsis orientalis OX=31958 GN=dpgD PE=1 SV=1
15	O53561	1.68e-35	130	266	0.290	0.316	ECH19_MYCTU Enoyl-CoA hydratase EchA19 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA19 PE=1 SV=2
16	Q96DC8	4.25e-35	130	303	0.286	0.274	ECHD3_HUMAN Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=ECHDC3 PE=1 SV=2
17	Q3MIE0	1.38e-34	129	300	0.269	0.260	ECHD3_RAT Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Echdc3 PE=2 SV=1
18	Q9D7J9	1.48e-33	126	300	0.266	0.257	ECHD3_MOUSE Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Mus musculus OX=10090 GN=Echdc3 PE=1 SV=1
19	P52045	2.02e-32	122	261	0.272	0.303	SCPB_ECOLI Methylmalonyl-CoA decarboxylase OS=Escherichia coli (strain K12) OX=83333 GN=scpB PE=1 SV=1
20	Q8GYN9	3.43e-32	123	337	0.297	0.255	MENB_ARATH 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=MENB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00378 ECH_1	6.8e-100	345.1	Enoyl-CoA hydratase/isomerase
2	PF16113 ECH_2	2.2e-37	140.9	Enoyl-CoA hydratase/isomerase
3	PF01343 Peptidase_S49	0.41	22.0	Peptidase family S49

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357535

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000474560	0.998	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
2	9606.ENSP00000168216	0.992	3-hydroxyacyl-CoA dehydrogenase type-2
3	9606.ENSP00000242592	0.992	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
4	9606.ENSP00000357873	0.983	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
5	9606.ENSP00000343657	0.979	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial
6	9606.ENSP00000438689	0.979	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
7	9606.ENSP00000301729	0.975	Enoyl-CoA delta isomerase 1, mitochondrial
8	9606.ENSP00000285093	0.972	3-ketoacyl-CoA thiolase, mitochondrial
9	9606.ENSP00000222214	0.967	Glutaryl-CoA dehydrogenase, mitochondrial
10	9606.ENSP00000233710	0.967	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
11	9606.ENSP00000418397	0.962	Isovaleryl-CoA dehydrogenase, mitochondrial
12	9606.ENSP00000352706	0.959	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial
13	9606.ENSP00000293217	0.955	Peroxisomal acyl-coenzyme A oxidase 1
14	9606.ENSP00000263702	0.953	Enoyl-[acyl-carrier-protein] reductase, mitochondrial
15	9606.ENSP00000265594	0.950	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial
16	9606.ENSP00000281182	0.949	Isobutyryl-CoA dehydrogenase, mitochondrial
17	9606.ENSP00000370023	0.947	Trifunctional enzyme subunit alpha, mitochondrial
18	9606.ENSP00000452762	0.947	Electron transfer flavoprotein subunit alpha, mitochondrial
19	9606.ENSP00000348775	0.942	Peroxisomal acyl-coenzyme A oxidase 3
20	9606.ENSP00000231887	0.939	Peroxisomal bifunctional enzyme

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004300	1.000	enoyl-CoA hydratase activity
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030258	0.996	lipid modification
GO:0016042	0.995	lipid catabolic process
GO:0072329	0.995	monocarboxylic acid catabolic process
GO:0009062	0.985	fatty acid catabolic process
GO:0006635	0.978	fatty acid beta-oxidation
GO:0006807	0.794	nitrogen compound metabolic process
GO:1901564	0.673	organonitrogen compound metabolic process
GO:0006520	0.351	amino acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0043233	0.960	organelle lumen
GO:0070013	0.951	intracellular organelle lumen
GO:0005759	0.792	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16105	1.000	a (3S)-3-hydroxyacyl-CoA = a (2E)-enoyl-CoA + H2O
EC:4.2.1.17	1.000	enoyl-CoA hydratase.

[back to server]