StarFunc result for job id P30101

User Input

>input (505 residues)
MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRD
NYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENI
FGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFA
VASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG
EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYL
QREATNPPVIQEEKPKKKKKAQEDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11598	0.907	0.907	4.354E-97	505	0.923	0.923	P11598.pdb.gz	PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus OX=10116 GN=Pdia3 PE=1 SV=2
2	PDB:3f8uA	0.901	0.968	9.740E-93	469	0.927	0.998	3f8uA.pdb.gz
3	AFDB:Q3YMU0	0.800	0.825	2.337E-61	489	0.459	0.474	Q3YMU0.pdb.gz	Q3YMU0_DROME Protein disulfide-isomerase (Fragment) OS=Drosophila melanogaster OX=7227 GN=ERp60 PE=1 SV=1
4	AFDB:G5ED07	0.711	0.732	6.049E-57	488	0.436	0.451	G5ED07.pdb.gz	G5ED07_CAEEL Protein disulfide-isomerase OS=Caenorhabditis elegans OX=6239 GN=pdi-3 PE=1 SV=1
5	AFDB:P34329	0.673	0.567	4.336E-55	618	0.392	0.320	P34329.pdb.gz	PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans OX=6239 GN=C14B9.2 PE=3 SV=2
6	AFDB:P38659	0.608	0.493	8.728E-54	643	0.374	0.294	P38659.pdb.gz	PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus OX=10116 GN=Pdia4 PE=1 SV=2
7	AFDB:P13667	0.595	0.483	7.023E-52	645	0.380	0.298	P13667.pdb.gz	PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2
8	AFDB:Q10057	0.618	0.632	4.817E-48	492	0.331	0.339	Q10057.pdb.gz	PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1F5.02 PE=3 SV=1
9	AFDB:Q9XI01	0.673	0.678	1.081E-47	501	0.347	0.349	Q9XI01.pdb.gz	PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-1 PE=1 SV=1
10	AFDB:Q4WH99	0.667	0.654	1.925E-47	517	0.349	0.340	Q4WH99.pdb.gz	Q4WH99_ASPFU Protein disulfide-isomerase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G06150 PE=3 SV=1
11	AFDB:Q9SRG3	0.691	0.688	1.925E-47	508	0.347	0.344	Q9SRG3.pdb.gz	PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-2 PE=2 SV=1
12	PDB:4ekzA	0.573	0.609	8.185E-42	469	0.315	0.339	4ekzA.pdb.gz
13	PDB:5gu6A	0.352	0.433	1.122E-20	377	0.152	0.204	5gu6A.pdb.gz
14	PDB:3apoA	0.194	0.148	5.334E-20	688	0.137	0.100	3apoA.pdb.gz
15	PDB:2r2jA	0.319	0.445	1.353E-18	328	0.139	0.213	2r2jA.pdb.gz
16	PDB:7f05C	0.480	0.640	1.353E-18	355	0.111	0.158	7f05C.pdb.gz	Ca2+-dependent Formation of a Non-transmembrane Channel in a Calsequestrin-2 Dimer
17	PDB:5crgA	0.472	0.630	7.216E-18	354	0.119	0.169	5crgA.pdb.gz	Characterization of Two Human Skeletal Calsequestrin Mutants Implicated in Malignant Hyperthermia and Vacuolar Aggregate Myopathy.
18	PDB:3ed3A	0.215	0.394	2.797E-13	267	0.119	0.225	3ed3A.pdb.gz
19	PDB:4f9zA	0.228	0.464	2.282E-9	219	0.075	0.174	4f9zA.pdb.gz
20	PDB:6yt3B	0.199	0.265	4.865E-8	376	0.117	0.157	6yt3B.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P11598	0.0	939	505	0.923	0.923	PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus OX=10116 GN=Pdia3 PE=1 SV=2
2	P27773	0.0	943	505	0.931	0.931	PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus OX=10090 GN=Pdia3 PE=1 SV=2
3	P30101	0.0	1044	505	1.000	1.000	PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4
4	Q4VIT4	0.0	1038	505	0.992	0.992	PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops OX=9534 GN=PDIA3 PE=1 SV=1
5	V9HVY3	0.0	1044	505	1.000	1.000	V9HVY3_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=HEL-S-269 PE=2 SV=1
6	Q3YMU0	9.95e-150	439	489	0.469	0.485	Q3YMU0_DROME Protein disulfide-isomerase (Fragment) OS=Drosophila melanogaster OX=7227 GN=ERp60 PE=1 SV=1
7	G5ED07	6.50e-140	414	488	0.453	0.469	G5ED07_CAEEL Protein disulfide-isomerase OS=Caenorhabditis elegans OX=6239 GN=pdi-3 PE=1 SV=1
8	P34329	1.09e-111	345	618	0.402	0.328	PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans OX=6239 GN=C14B9.2 PE=3 SV=2
9	P13667	3.83e-111	345	645	0.396	0.310	PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2
10	P08003	9.99e-110	341	638	0.390	0.309	PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus OX=10090 GN=Pdia4 PE=1 SV=3
11	P38659	1.30e-108	338	643	0.384	0.302	PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus OX=10116 GN=Pdia4 PE=1 SV=2
12	Q95T75	2.45e-107	326	364	0.335	0.464	Q95T75_DROME Protein disulfide-isomerase OS=Drosophila melanogaster OX=7227 GN=ERp60 PE=2 SV=1
13	A2QFJ8	4.72e-91	289	515	0.349	0.342	A2QFJ8_ASPNC Protein disulfide-isomerase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=pdiA PE=3 SV=1
14	Q4WH99	6.11e-88	281	517	0.360	0.352	Q4WH99_ASPFU Protein disulfide-isomerase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G06150 PE=3 SV=1
15	Q43116	1.89e-87	279	498	0.370	0.376	PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis OX=3988 PE=2 SV=1
16	Q9SRG3	4.23e-86	276	508	0.341	0.339	PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-2 PE=2 SV=1
17	Q9XI01	1.59e-84	271	501	0.358	0.361	PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-1 PE=1 SV=1
18	Q17770	3.77e-84	270	493	0.339	0.347	PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans OX=6239 GN=pdi-2 PE=1 SV=1
19	Q53LQ0	7.74e-84	270	512	0.341	0.336	PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica OX=39947 GN=PDIL1-1 PE=2 SV=1
20	Q10057	3.51e-83	268	492	0.315	0.323	PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1F5.02 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00578 AhpC-TSA	0.6	21.4	AhpC/TSA family
2	PF04756 OST3_OST6	0.32	21.9	OST3 / OST6 family, transporter family
3	PF08534 Redoxin	43	15.3	Redoxin
4	PF00085 Thioredoxin	6.2e-64	223.8	Thioredoxin
5	PF13098 Thioredoxin_2	1.1e-05	37.3	Thioredoxin-like domain
6	PF13192 Thioredoxin_3	84	14.6	Thioredoxin domain
7	PF13462 Thioredoxin_4	1.5	20.4	Thioredoxin
8	PF13848 Thioredoxin_6	5.1e-30	116.2	Thioredoxin-like domain
9	PF13899 Thioredoxin_7	0.0091	27.5	Thioredoxin-like
10	PF13905 Thioredoxin_8	0.00048	31.7	Thioredoxin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300289

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247461	0.999	Calnexin
2	9606.ENSP00000320866	0.999	Calreticulin
3	9606.ENSP00000404833	0.999	Tapasin
4	9606.ENSP00000452780	0.996	Beta-2-microglobulin
5	9606.ENSP00000324173	0.995	78 kDa glucose-regulated protein
6	9606.ENSP00000379873	0.993	HLA class I histocompatibility antigen, A-3 alpha chain
7	9606.ENSP00000264657	0.989	Signal transducer and activator of transcription 3
8	9606.ENSP00000346206	0.987	Antigen peptide transporter 1
9	9606.ENSP00000299767	0.985	Endoplasmin
10	9606.ENSP00000266397	0.964	Endoplasmic reticulum protein 27
11	9606.ENSP00000478059	0.958	Stromal interaction molecule 1
12	9606.ENSP00000340466	0.954	Neutral alpha-glucosidase AB
13	9606.ENSP00000300026	0.935	Peptidyl-prolyl cis-trans isomerase B
14	9606.ENSP00000466134	0.935	Glucosidase 2 subunit beta
15	9606.ENSP00000379042	0.934	ERO1-like protein alpha
16	9606.ENSP00000364034	0.928	Antigen peptide transporter 2
17	9606.ENSP00000385385	0.928	Protein disulfide-isomerase A6
18	9606.ENSP00000480150	0.928	Hypoxia up-regulated protein 1
19	9606.ENSP00000249647	0.912	Synaptosomal-associated protein 23
20	9606.ENSP00000237530	0.909	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140096	0.998	catalytic activity, acting on a protein
GO:0005515	0.998	protein binding
GO:0016667	0.984	oxidoreductase activity, acting on a sulfur group of donors
GO:0015036	0.961	disulfide oxidoreductase activity
GO:0016853	0.952	isomerase activity
GO:0015035	0.946	protein-disulfide reductase activity
GO:0003756	0.880	protein disulfide isomerase activity
GO:0008233	0.728	peptidase activity
GO:0097159	0.470	organic cyclic compound binding
GO:1901363	0.454	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0065007	0.981	biological regulation
GO:0050789	0.973	regulation of biological process
GO:0050896	0.970	response to stimulus
GO:0050794	0.963	regulation of cellular process
GO:0051716	0.911	cellular response to stimulus
GO:0048518	0.794	positive regulation of biological process
GO:0006457	0.766	protein folding
GO:0071840	0.760	cellular component organization or biogenesis
GO:0016043	0.748	cellular component organization
GO:0042221	0.730	response to chemical
GO:0010033	0.669	response to organic substance
GO:0007154	0.666	cell communication
GO:0048522	0.623	positive regulation of cellular process
GO:0002376	0.597	immune system process
GO:0019882	0.546	antigen processing and presentation
GO:0006950	0.419	response to stress
GO:0008152	0.389	metabolic process
GO:0071704	0.367	organic substance metabolic process
GO:0048519	0.330	negative regulation of biological process
GO:0048583	0.322	regulation of response to stimulus
GO:0048523	0.314	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0070013	0.968	intracellular organelle lumen
GO:0031982	0.903	vesicle
GO:0005576	0.883	extracellular region
GO:0016020	0.863	membrane
GO:0005615	0.722	extracellular space
GO:0009986	0.685	cell surface
GO:0032991	0.364	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.-.-	0.984	Acting on a sulfur group of donors.
EC:5.-.-.-	0.952	Isomerases.
EC:5.3.4.1	0.880	protein disulfide-isomerase.
EC:3.4.-.-	0.728	Acting on peptide bonds (peptidases).

[back to server]