StarFunc result for job id P30153

User Input

>input (589 residues)
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K7B7	0.924	0.924	3.671E-66	589	1.000	1.000	A8K7B7.pdb.gz	A8K7B7_HUMAN Protein phosphatase 2 (Formerly 2A), regulatory subunit A (PR 65), alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=1
2	PDB:1b3uA	0.721	0.722	3.340E-60	588	0.998	1.000	1b3uA.pdb.gz
3	AFDB:P30154	0.942	0.924	2.689E-58	601	0.861	0.844	P30154.pdb.gz	2AAB_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B PE=1 SV=3
4	AFDB:P36179	0.826	0.823	6.021E-54	591	0.747	0.745	P36179.pdb.gz	2AAA_DROME Serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pp2A-29B PE=1 SV=4
5	AFDB:Q09543	0.792	0.791	2.169E-47	590	0.621	0.620	Q09543.pdb.gz	2AAA_CAEEL Probable serine/threonine-protein phosphatase PP2A regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=paa-1 PE=1 SV=2
6	AFDB:Q38845	0.884	0.886	1.540E-46	588	0.584	0.585	Q38845.pdb.gz	2AAA_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA1 PE=1 SV=1
7	AFDB:Q54QR9	0.855	0.862	5.484E-46	584	0.576	0.580	Q54QR9.pdb.gz	2AAA_DICDI Protein phosphatase 2A scaffold subunit OS=Dictyostelium discoideum OX=44689 GN=pppA PE=1 SV=1
8	AFDB:Q38950	0.793	0.796	1.175E-45	587	0.574	0.576	Q38950.pdb.gz	2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA2 PE=1 SV=2
9	PDB:7k36A	0.736	0.776	1.792E-44	554	0.935	0.995	7k36A.pdb.gz	Cryo-EM structure of the Hippo signaling integrator human STRIPAK.
10	AFDB:Q9UT08	0.836	0.835	3.092E-42	590	0.525	0.524	Q9UT08.pdb.gz	2AAA_SCHPO Protein phosphatase PP2A regulatory subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=paa1 PE=1 SV=1
11	AFDB:P31383	0.869	0.810	3.191E-35	635	0.443	0.411	P31383.pdb.gz	2AAA_YEAST Protein phosphatase PP2A regulatory subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPD3 PE=1 SV=3
12	AFDB:Q5ADN1	0.867	0.799	3.968E-35	643	0.441	0.404	Q5ADN1.pdb.gz	Q5ADN1_CANAL Protein phosphatase 2A structural subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TPD3 PE=4 SV=1
13	PDB:5gm6G	0.441	0.327	1.596E-10	875	0.205	0.138	5gm6G.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:6ahd1	0.424	0.275	6.112E-10	1048	0.185	0.104	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
15	PDB:6xu2A	0.394	0.239	9.797E-10	1091	0.166	0.090	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
16	PDB:4a0cA	0.554	0.312	1.175E-9	1155	0.144	0.074	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
17	PDB:4jlqA	0.403	0.306	2.257E-9	840	0.154	0.108	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
18	PDB:3w3uA	0.469	0.288	4.035E-9	1030	0.165	0.094	3w3uA.pdb.gz
19	PDB:7nscE	0.311	0.301	6.236E-9	615	0.165	0.158	7nscE.pdb.gz
20	PDB:7rroH7	0.330	0.334	6.954E-9	580	0.144	0.147	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K7B7	0.0	1204	589	1.000	1.000	A8K7B7_HUMAN Protein phosphatase 2 (Formerly 2A), regulatory subunit A (PR 65), alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=1
2	P30153	0.0	1204	589	1.000	1.000	2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4
3	P30154	0.0	1040	601	0.852	0.835	2AAB_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B PE=1 SV=3
4	P36179	0.0	859	591	0.742	0.739	2AAA_DROME Serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pp2A-29B PE=1 SV=4
5	Q09543	0.0	740	590	0.621	0.620	2AAA_CAEEL Probable serine/threonine-protein phosphatase PP2A regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=paa-1 PE=1 SV=2
6	Q32PI5	0.0	1197	589	0.993	0.993	2AAA_BOVIN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Bos taurus OX=9913 GN=PPP2R1A PE=1 SV=1
7	Q38845	0.0	692	588	0.582	0.583	2AAA_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA1 PE=1 SV=1
8	Q38950	0.0	694	587	0.574	0.576	2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA2 PE=1 SV=2
9	Q38951	0.0	691	587	0.576	0.578	2AAG_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA3 PE=1 SV=2
10	Q54QR9	0.0	666	584	0.574	0.579	2AAA_DICDI Protein phosphatase 2A scaffold subunit OS=Dictyostelium discoideum OX=44689 GN=pppA PE=1 SV=1
11	Q76MZ3	0.0	1202	589	0.998	0.998	2AAA_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus OX=10090 GN=Ppp2r1a PE=1 SV=3
12	Q7TNP2	0.0	1048	601	0.856	0.839	2AAB_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Mus musculus OX=10090 GN=Ppp2r1b PE=1 SV=2
13	Q9UT08	0.0	620	590	0.526	0.525	2AAA_SCHPO Protein phosphatase PP2A regulatory subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=paa1 PE=1 SV=1
14	P31383	2.80e-164	484	635	0.448	0.416	2AAA_YEAST Protein phosphatase PP2A regulatory subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPD3 PE=1 SV=3
15	Q5ADN1	1.19e-150	450	643	0.450	0.412	Q5ADN1_CANAL Protein phosphatase 2A structural subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TPD3 PE=4 SV=1
16	A6MUT0	1.77e-99	304	245	0.255	0.612	A6MUT0_GOSHI Protein phosphatase (Fragment) OS=Gossypium hirsutum OX=3635 PE=2 SV=1
17	Q4GZ81	5.44e-95	303	573	0.358	0.368	Q4GZ81_TRYB2 Serine/threonine protein phosphatase 2a regulatory subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1380 PE=4 SV=1
18	Q8TF05	8.24e-11	67.4	950	0.129	0.080	PP4R1_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP4R1 PE=1 SV=1
19	F1MRS1	2.62e-10	65.9	893	0.126	0.083	F1MRS1_BOVIN Protein phosphatase 4 regulatory subunit 1 OS=Bos taurus OX=9913 GN=PPP4R1 PE=1 SV=3
20	Q385S3	1.22e-08	60.5	786	0.175	0.131	Q385S3_TRYB2 Serine/threonine-protein phosphatase 4 regulatory subunit 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2560 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	6.3e-05	33.4	Adaptin N terminal region
2	PF12348 CLASP_N	0.0031	28.7	CLASP N terminal
3	PF12717 Cnd1	8.4e-06	37.4	non-SMC mitotic condensation complex subunit 1
4	PF02985 HEAT	8.1e-47	164.2	HEAT repeat
5	PF13646 HEAT_2	8.2e-44	159.3	HEAT repeats
6	PF13513 HEAT_EZ	6.6e-09	47.4	HEAT-like repeat
7	PF03130 HEAT_PBS	1.1e+02	14.8	PBS lyase HEAT-like repeat
8	PF05004 IFRD	1.2e+02	13.2	Interferon-related developmental regulator (IFRD)
9	PF11099 M11L	0.23	23.2	Apoptosis regulator M11L like
10	PF16469 NPA	60	15.7	Nematode polyprotein allergen ABA-1
11	PF20168 PDS5	0.0002	31.0	Sister chromatid cohesion protein PDS5 protein
12	PF08324 PUL	4.7e+02	11.4	PUL domain
13	PF10957 Spore_Cse60	4.4e+02	12.3	Sporulation protein Cse60
14	PF07571 TAF6_C	0.21	23.2	TAF6 C-terminal HEAT repeat domain
15	PF12755 Vac14_Fab1_bd	4.4e-11	54.6	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010374830.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010351939.1	0.999	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform isoform X1
2	61622.XP_010358166.1	0.999	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform isoform X1
3	61622.XP_010358250.1	0.999	Protein phosphatase 2 catalytic subunit alpha
4	61622.XP_010369172.1	0.999	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
5	61622.XP_010370783.1	0.999	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
6	61622.XP_010376443.1	0.999	Belongs to the phosphatase 2A regulatory subunit B family.
7	61622.XP_010362265.1	0.998	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform isoform X1
8	61622.XP_010367996.1	0.998	The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
9	61622.XP_010368347.1	0.998	Protein phosphatase 2, regulatory subunit B, gamma
10	61622.XP_010376401.1	0.998	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform isoform X1
11	61622.XP_010362797.1	0.997	Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
12	61622.XP_010358773.1	0.996	Sarcolemmal membrane-associated protein
13	61622.XP_010371491.1	0.996	Striatin
14	61622.XP_010380628.1	0.996	Protein phosphatase 2 scaffold subunit Abeta
15	61622.XP_010353314.1	0.995	Programmed cell death 10
16	61622.XP_010372964.1	0.995	Striatin 3
17	61622.XP_010381685.1	0.995	Belongs to the phosphatase 2A regulatory subunit B family.
18	61622.XP_010384554.1	0.995	Striatin interacting protein 1
19	61622.XP_010357369.1	0.994	CTTNBP2 N-terminal like
20	61622.XP_010365128.1	0.994	Demethylates proteins that have been reversibly carboxymethylated

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.483	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0008152	0.831	metabolic process
GO:0048518	0.827	positive regulation of biological process
GO:0048522	0.818	positive regulation of cellular process
GO:0044237	0.802	cellular metabolic process
GO:0071704	0.702	organic substance metabolic process
GO:0044238	0.701	primary metabolic process
GO:0006807	0.698	nitrogen compound metabolic process
GO:0048583	0.651	regulation of response to stimulus
GO:0071840	0.640	cellular component organization or biogenesis
GO:0043170	0.635	macromolecule metabolic process
GO:0009966	0.629	regulation of signal transduction
GO:0016043	0.615	cellular component organization
GO:0048519	0.560	negative regulation of biological process
GO:0048523	0.518	negative regulation of cellular process
GO:0048584	0.495	positive regulation of response to stimulus
GO:0050896	0.452	response to stimulus
GO:0019538	0.417	protein metabolic process
GO:0009967	0.383	positive regulation of signal transduction
GO:0007049	0.362	cell cycle
GO:0043412	0.358	macromolecule modification
GO:0022402	0.349	cell cycle process
GO:0036211	0.344	protein modification process
GO:0060255	0.332	regulation of macromolecule metabolic process
GO:0032502	0.328	developmental process
GO:0051716	0.319	cellular response to stimulus
GO:0080090	0.317	regulation of primary metabolic process
GO:0051171	0.311	regulation of nitrogen compound metabolic process
GO:0031323	0.311	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0043226	0.999	organelle
GO:0005829	0.999	cytosol
GO:0043227	0.988	membrane-bounded organelle
GO:0043231	0.979	intracellular membrane-bounded organelle
GO:0016020	0.977	membrane
GO:1902494	0.976	catalytic complex
GO:0005634	0.958	nucleus
GO:0071944	0.942	cell periphery
GO:0043228	0.940	non-membrane-bounded organelle
GO:0043233	0.940	organelle lumen
GO:0043232	0.926	intracellular non-membrane-bounded organelle
GO:0031981	0.915	nuclear lumen
GO:0005576	0.898	extracellular region
GO:0031982	0.897	vesicle
GO:0005654	0.888	nucleoplasm
GO:0005886	0.869	plasma membrane
GO:0005615	0.867	extracellular space
GO:0070062	0.820	extracellular exosome
GO:1903293	0.783	phosphatase complex
GO:0008287	0.649	protein serine/threonine phosphatase complex
GO:0000159	0.462	protein phosphatase type 2A complex
GO:0030054	0.356	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]