StarFunc result for job id P30154

User Input

>input (601 residues)
MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTR
SELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKA
VESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQ
QFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEAC
VSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQ
NLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASV
IMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMK
LVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKM
AGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLAL
A

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30154	1.000	1.000	2.468E-70	601	1.000	1.000	P30154.pdb.gz	2AAB_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B PE=1 SV=3
2	AFDB:A8K7B7	0.914	0.931	1.835E-58	589	0.844	0.861	A8K7B7.pdb.gz	A8K7B7_HUMAN Protein phosphatase 2 (Formerly 2A), regulatory subunit A (PR 65), alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=1
3	PDB:1b3uA	0.733	0.748	4.431E-55	588	0.840	0.859	1b3uA.pdb.gz
4	AFDB:P36179	0.883	0.897	8.801E-55	591	0.700	0.712	P36179.pdb.gz	2AAA_DROME Serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pp2A-29B PE=1 SV=4
5	AFDB:Q09543	0.849	0.863	2.715E-47	590	0.602	0.614	Q09543.pdb.gz	2AAA_CAEEL Probable serine/threonine-protein phosphatase PP2A regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=paa-1 PE=1 SV=2
6	AFDB:Q38845	0.931	0.951	2.281E-46	588	0.552	0.565	Q38845.pdb.gz	2AAA_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA1 PE=1 SV=1
7	AFDB:Q54QR9	0.903	0.928	3.059E-46	584	0.559	0.575	Q54QR9.pdb.gz	2AAA_DICDI Protein phosphatase 2A scaffold subunit OS=Dictyostelium discoideum OX=44689 GN=pppA PE=1 SV=1
8	AFDB:Q38950	0.840	0.858	1.654E-45	587	0.542	0.555	Q38950.pdb.gz	2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA2 PE=1 SV=2
9	AFDB:Q9UT08	0.884	0.900	3.539E-42	590	0.506	0.515	Q9UT08.pdb.gz	2AAA_SCHPO Protein phosphatase PP2A regulatory subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=paa1 PE=1 SV=1
10	PDB:7k36A	0.726	0.779	1.455E-40	554	0.800	0.868	7k36A.pdb.gz	Cryo-EM structure of the Hippo signaling integrator human STRIPAK.
11	AFDB:P31383	0.924	0.876	2.684E-36	635	0.439	0.416	P31383.pdb.gz	2AAA_YEAST Protein phosphatase PP2A regulatory subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPD3 PE=1 SV=3
12	AFDB:Q5ADN1	0.900	0.844	4.206E-35	643	0.428	0.400	Q5ADN1.pdb.gz	Q5ADN1_CANAL Protein phosphatase 2A structural subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TPD3 PE=4 SV=1
13	PDB:6ahd1	0.430	0.283	3.424E-10	1048	0.183	0.105	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
14	PDB:4jlqA	0.407	0.314	1.237E-9	840	0.158	0.113	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
15	PDB:4a0cA	0.576	0.331	1.541E-9	1155	0.148	0.077	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
16	PDB:7unkA	0.356	0.226	2.144E-9	1047	0.193	0.111	7unkA.pdb.gz
17	PDB:7rroH7	0.325	0.334	2.576E-9	580	0.133	0.138	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:6xu2A	0.357	0.226	3.094E-9	1091	0.180	0.099	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
19	PDB:3w3uA	0.441	0.278	3.454E-9	1030	0.166	0.097	3w3uA.pdb.gz
20	PDB:5gm6G	0.448	0.333	1.445E-8	875	0.193	0.133	5gm6G.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K7B7	0.0	1050	589	0.844	0.861	A8K7B7_HUMAN Protein phosphatase 2 (Formerly 2A), regulatory subunit A (PR 65), alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=1
2	P30153	0.0	1050	589	0.844	0.861	2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4
3	P30154	0.0	1226	601	1.000	1.000	2AAB_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B PE=1 SV=3
4	P36179	0.0	822	591	0.692	0.704	2AAA_DROME Serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pp2A-29B PE=1 SV=4
5	Q09543	0.0	735	590	0.604	0.615	2AAA_CAEEL Probable serine/threonine-protein phosphatase PP2A regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=paa-1 PE=1 SV=2
6	Q32PI5	0.0	1047	589	0.842	0.859	2AAA_BOVIN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Bos taurus OX=9913 GN=PPP2R1A PE=1 SV=1
7	Q38845	0.0	663	588	0.552	0.565	2AAA_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA1 PE=1 SV=1
8	Q38950	0.0	664	587	0.544	0.557	2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA2 PE=1 SV=2
9	Q38951	0.0	659	587	0.544	0.557	2AAG_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA3 PE=1 SV=2
10	Q54QR9	0.0	655	584	0.557	0.574	2AAA_DICDI Protein phosphatase 2A scaffold subunit OS=Dictyostelium discoideum OX=44689 GN=pppA PE=1 SV=1
11	Q76MZ3	0.0	1050	589	0.844	0.861	2AAA_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus OX=10090 GN=Ppp2r1a PE=1 SV=3
12	Q7TNP2	0.0	1145	601	0.928	0.928	2AAB_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Mus musculus OX=10090 GN=Ppp2r1b PE=1 SV=2
13	Q9UT08	0.0	608	590	0.512	0.522	2AAA_SCHPO Protein phosphatase PP2A regulatory subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=paa1 PE=1 SV=1
14	P31383	4.53e-165	487	635	0.443	0.419	2AAA_YEAST Protein phosphatase PP2A regulatory subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPD3 PE=1 SV=3
15	Q5ADN1	4.32e-148	444	643	0.431	0.403	Q5ADN1_CANAL Protein phosphatase 2A structural subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TPD3 PE=4 SV=1
16	A6MUT0	1.00e-94	292	245	0.246	0.604	A6MUT0_GOSHI Protein phosphatase (Fragment) OS=Gossypium hirsutum OX=3635 PE=2 SV=1
17	Q4GZ81	9.55e-91	293	573	0.338	0.354	Q4GZ81_TRYB2 Serine/threonine protein phosphatase 2a regulatory subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1380 PE=4 SV=1
18	F1MRS1	4.75e-10	65.1	893	0.116	0.078	F1MRS1_BOVIN Protein phosphatase 4 regulatory subunit 1 OS=Bos taurus OX=9913 GN=PPP4R1 PE=1 SV=3
19	Q385S3	2.77e-09	62.4	786	0.155	0.118	Q385S3_TRYB2 Serine/threonine-protein phosphatase 4 regulatory subunit 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2560 PE=4 SV=1
20	Q8TF05	9.42e-09	60.8	950	0.111	0.071	PP4R1_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP4R1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	1.7e-06	38.5	Adaptin N terminal region
2	PF12348 CLASP_N	0.13	23.3	CLASP N terminal
3	PF12717 Cnd1	8.2e-07	40.7	non-SMC mitotic condensation complex subunit 1
4	PF02985 HEAT	7e-48	167.5	HEAT repeat
5	PF13646 HEAT_2	4.6e-43	156.8	HEAT repeats
6	PF13513 HEAT_EZ	1.3e-09	49.6	HEAT-like repeat
7	PF03130 HEAT_PBS	7.6e+02	12.3	PBS lyase HEAT-like repeat
8	PF11099 M11L	0.025	26.3	Apoptosis regulator M11L like
9	PF20168 PDS5	4.5e-05	33.1	Sister chromatid cohesion protein PDS5 protein
10	PF07571 TAF6_C	4.1	19.1	TAF6 C-terminal HEAT repeat domain
11	PF12755 Vac14_Fab1_bd	3e-11	55.1	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311344

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261461	0.999	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
2	9606.ENSP00000335083	0.999	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform
3	9606.ENSP00000418447	0.999	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
4	9606.ENSP00000221138	0.998	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
5	9606.ENSP00000263918	0.998	Striatin
6	9606.ENSP00000324804	0.998	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
7	9606.ENSP00000325074	0.997	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
8	9606.ENSP00000350071	0.997	Striatin-3
9	9606.ENSP00000337641	0.996	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform
10	9606.ENSP00000412324	0.996	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
11	9606.ENSP00000417963	0.995	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
12	9606.ENSP00000325748	0.994	Serine/threonine-protein kinase 25
13	9606.ENSP00000365730	0.994	Serine/threonine-protein kinase 24
14	9606.ENSP00000399970	0.993	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
15	9606.ENSP00000355991	0.992	TRAF3-interacting JNK-activating modulator
16	9606.ENSP00000358541	0.992	Suppressor of IKBKE 1
17	9606.ENSP00000382021	0.990	Leucine carboxyl methyltransferase 1
18	9606.ENSP00000377936	0.989	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
19	9606.ENSP00000377036	0.986	Serine/threonine-protein phosphatase 2A activator
20	9606.ENSP00000164133	0.974	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.978	regulation of cellular process
GO:0048518	0.861	positive regulation of biological process
GO:0048522	0.777	positive regulation of cellular process
GO:0008152	0.655	metabolic process
GO:0048583	0.648	regulation of response to stimulus
GO:0009966	0.637	regulation of signal transduction
GO:0044237	0.596	cellular metabolic process
GO:0044238	0.595	primary metabolic process
GO:0071704	0.593	organic substance metabolic process
GO:0006807	0.570	nitrogen compound metabolic process
GO:0048523	0.569	negative regulation of cellular process
GO:0071840	0.539	cellular component organization or biogenesis
GO:0043170	0.528	macromolecule metabolic process
GO:0016043	0.518	cellular component organization
GO:0048584	0.512	positive regulation of response to stimulus
GO:0050896	0.511	response to stimulus
GO:0023056	0.418	positive regulation of signaling
GO:0010647	0.418	positive regulation of cell communication
GO:0009967	0.413	positive regulation of signal transduction
GO:0023052	0.399	signaling
GO:0019538	0.390	protein metabolic process
GO:0022402	0.389	cell cycle process
GO:0036211	0.376	protein modification process
GO:0019222	0.353	regulation of metabolic process
GO:0051716	0.347	cellular response to stimulus
GO:0007154	0.338	cell communication
GO:0060255	0.319	regulation of macromolecule metabolic process
GO:0007165	0.316	signal transduction
GO:0032501	0.312	multicellular organismal process
GO:0080090	0.302	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.998	intracellular organelle
GO:0005829	0.997	cytosol
GO:0071944	0.987	cell periphery
GO:0005886	0.980	plasma membrane
GO:0043231	0.971	intracellular membrane-bounded organelle
GO:0070013	0.971	intracellular organelle lumen
GO:0005634	0.962	nucleus
GO:0031981	0.945	nuclear lumen
GO:1902494	0.923	catalytic complex
GO:0043228	0.863	non-membrane-bounded organelle
GO:0043232	0.849	intracellular non-membrane-bounded organelle
GO:0031982	0.841	vesicle
GO:0005654	0.800	nucleoplasm
GO:0005576	0.789	extracellular region
GO:0005615	0.649	extracellular space
GO:1903293	0.572	phosphatase complex
GO:0008287	0.546	protein serine/threonine phosphatase complex
GO:0000159	0.399	protein phosphatase type 2A complex
GO:1903561	0.340	extracellular vesicle
GO:0012505	0.316	endomembrane system
GO:0070062	0.307	extracellular exosome
GO:0030054	0.306	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]