StarFunc result for job id P30203

User Input

>input (668 residues)
MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEV
RLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANAT
LAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHG
EWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDC
PGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAK
VLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLC
SASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELMLLIPSIVLGILLLGSLIFIA
FILLRIKGKYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDS
GSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTA
NPGHCITDPPSLGPQYHPRSNSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPP
NLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDND
DYDDISAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30203	0.999	0.999	0.000	668	1.000	1.000	P30203.pdb.gz	CD6_HUMAN T-cell differentiation antigen CD6 OS=Homo sapiens OX=9606 GN=CD6 PE=1 SV=3
2	AFDB:G3V8U0	0.528	0.530	1.874E-83	665	0.710	0.713	G3V8U0.pdb.gz	G3V8U0_RAT Cd6 molecule OS=Rattus norvegicus OX=10116 GN=Cd6 PE=4 SV=1
3	AFDB:Q61003	0.623	0.626	3.950E-83	665	0.704	0.707	Q61003.pdb.gz	CD6_MOUSE T-cell differentiation antigen CD6 OS=Mus musculus OX=10090 GN=Cd6 PE=1 SV=2
4	AFDB:Q5FVU4	0.465	0.518	1.423E-71	597	0.594	0.665	Q5FVU4.pdb.gz	Q5FVU4_RAT Cd6 molecule OS=Rattus norvegicus OX=10116 GN=Cd6 PE=2 SV=1
5	AFDB:D3ZVW6	0.300	0.597	1.929E-33	325	0.295	0.606	D3ZVW6.pdb.gz	D3ZVW6_RAT Cd6 molecule OS=Rattus norvegicus OX=10116 GN=Cd6 PE=4 SV=4
6	PDB:2xrcC	0.136	0.195	2.475E-6	454	0.043	0.064	2xrcC.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
7	PDB:2xrcB	0.133	0.180	6.506E-5	485	0.045	0.062	2xrcB.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
8	AFDB:M0R9F7	0.144	0.203	2.227E-3	470	0.108	0.153	M0R9F7.pdb.gz	M0R9F7_RAT Macrophage receptor with collagenous structure OS=Rattus norvegicus OX=10116 GN=Marco PE=4 SV=3
9	AFDB:E9QJQ6	0.063	0.041	9.807E-2	1119	0.126	0.075	E9QJQ6.pdb.gz	MEG10_DANRE Multiple epidermal growth factor-like domains protein 10 OS=Danio rerio OX=7955 GN=megf10 PE=1 SV=1
10	AFDB:O35569	0.056	0.046	1.100E-1	868	0.162	0.124	O35569.pdb.gz	NRG2_RAT Pro-neuregulin-2, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg2 PE=1 SV=1
11	AFDB:Q9Y5I3	0.076	0.057	1.100E-1	950	0.094	0.066	Q9Y5I3.pdb.gz	PCDA1_HUMAN Protocadherin alpha-1 OS=Homo sapiens OX=9606 GN=PCDHA1 PE=2 SV=1
12	AFDB:Q9VAF5	0.078	0.040	1.843E-1	1706	0.114	0.045	Q9VAF5.pdb.gz	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
13	PDB:6xt9A	0.070	0.077	4.456E-1	567	0.040	0.048	6xt9A.pdb.gz
14	PDB:4o9yA	0.050	0.020	1.325	2490	0.042	0.011	4o9yA.pdb.gz
15	PDB:7eu0M	0.068	0.046	4.171	1052	0.016	0.010	7eu0M.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
16	PDB:7ajtEH	0.069	0.128	4.678	237	0.027	0.076	7ajtEH.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:6yo9A	0.052	0.072	6.232	398	0.037	0.063	6yo9A.pdb.gz	Degradation of the microbial stress protectants and chemical chaperones ectoine and hydroxyectoine by a bacterial hydrolase-deacetylase complex.
18	PDB:7odrS	0.032	0.091	6.600	161	0.021	0.087	7odrS.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
19	PDB:1nyeD	0.039	0.091	7.839	162	0.022	0.093	1nyeD.pdb.gz
20	PDB:7qsrA	0.066	0.045	8.302	1335	0.039	0.019	7qsrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V8U0	0.0	884	665	0.695	0.698	G3V8U0_RAT Cd6 molecule OS=Rattus norvegicus OX=10116 GN=Cd6 PE=4 SV=1
2	P30203	0.0	1363	668	1.000	1.000	CD6_HUMAN T-cell differentiation antigen CD6 OS=Homo sapiens OX=9606 GN=CD6 PE=1 SV=3
3	Q5FVU4	0.0	791	597	0.602	0.673	Q5FVU4_RAT Cd6 molecule OS=Rattus norvegicus OX=10116 GN=Cd6 PE=2 SV=1
4	Q61003	0.0	875	665	0.686	0.689	CD6_MOUSE T-cell differentiation antigen CD6 OS=Mus musculus OX=10090 GN=Cd6 PE=1 SV=2
5	Q812A4	0.0	884	665	0.695	0.698	Q812A4_RAT CD6 antigen OS=Rattus norvegicus OX=10116 GN=Cd6 PE=2 SV=1
6	D3ZVW6	2.80e-127	384	390	0.352	0.603	D3ZVW6_RAT Cd6 molecule OS=Rattus norvegicus OX=10116 GN=Cd6 PE=4 SV=4
7	Q9UGM3	9.68e-62	226	2413	0.247	0.068	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
8	Q60997	2.93e-55	206	2085	0.241	0.077	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
9	B3F5L4	1.11e-50	192	1112	0.181	0.109	B3F5L4_MOUSE SCART2 splice variant A OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
10	B3F5L5	1.66e-50	191	996	0.180	0.120	B3F5L5_MOUSE SCART2 splice variant B OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
11	Q8CIZ5	4.60e-49	187	1418	0.202	0.095	DMBT1_RAT Deleted in malignant brain tumors 1 protein OS=Rattus norvegicus OX=10116 GN=Dmbt1 PE=1 SV=1
12	Q8CGY7	6.13e-48	184	989	0.168	0.113	Q8CGY7_MOUSE Scavenger receptor cysteine-rich type 1 protein CD163c-alpha OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
13	Q8BIC8	6.21e-48	184	991	0.168	0.113	Q8BIC8_MOUSE SRCR domain-containing protein OS=Mus musculus OX=10090 GN=Scart1 PE=2 SV=1
14	A0A1B0GSB0	7.48e-48	183	991	0.168	0.113	A0A1B0GSB0_MOUSE Scavenger receptor family member expressed on T cells 1 OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
15	Q86VB7	1.10e-47	183	1156	0.172	0.099	C163A_HUMAN Scavenger receptor cysteine-rich type 1 protein M130 OS=Homo sapiens OX=9606 GN=CD163 PE=1 SV=2
16	O43866	1.44e-47	173	347	0.187	0.360	CD5L_HUMAN CD5 antigen-like OS=Homo sapiens OX=9606 GN=CD5L PE=1 SV=1
17	A0A0G2JVY2	1.14e-46	180	1151	0.184	0.107	A0A0G2JVY2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=2
18	A0A8I5ZQF0	1.20e-46	180	1109	0.184	0.111	A0A8I5ZQF0_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=1
19	D3Z9U2	2.18e-46	179	1110	0.186	0.112	D3Z9U2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=4 SV=2
20	Q9QWK4	5.19e-40	152	352	0.157	0.298	CD5L_MOUSE CD5 antigen-like OS=Mus musculus OX=10090 GN=Cd5l PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00530 SRCR	1.6e-60	213.0	Scavenger receptor cysteine-rich domain
2	PF15494 SRCR_2	2.2e-05	36.4	Scavenger receptor cysteine-rich domain
3	PF15102 TMEM154	2.6e+02	12.8	TMEM154 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323280

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305988	0.999	CD166 antigen
2	9606.ENSP00000046794	0.981	Lymphocyte cytosolic protein 2
3	9606.ENSP00000260130	0.949	Syntenin-1
4	9606.ENSP00000358490	0.891	T-cell surface antigen CD2
5	9606.ENSP00000342681	0.850	T-cell surface glycoprotein CD5
6	9606.ENSP00000337825	0.765	Tyrosine-protein kinase Lck
7	9606.ENSP00000227880	0.764	Solute carrier family 15 member 3
8	9606.ENSP00000312027	0.725	T-cell antigen CD7
9	9606.ENSP00000386559	0.689	T-cell surface glycoprotein CD8 alpha chain
10	9606.ENSP00000338171	0.681	Src kinase-associated phosphoprotein 1
11	9606.ENSP00000296129	0.667	CUB domain-containing protein 1
12	9606.ENSP00000312942	0.667	Seizure protein 6 homolog
13	9606.ENSP00000011653	0.654	T-cell surface glycoprotein CD4
14	9606.ENSP00000217456	0.642	Adipocyte plasma membrane-associated protein
15	9606.ENSP00000398655	0.638	Tyrosine-protein kinase ITK/TSK
16	9606.ENSP00000356016	0.618	Complement receptor type 1
17	9606.ENSP00000400010	0.614	Receptor-type tyrosine-protein phosphatase eta
18	9606.ENSP00000407822	0.602	Contactin-6
19	9606.ENSP00000354566	0.601	T-cell surface glycoprotein CD3 epsilon chain
20	9606.ENSP00000300692	0.581	T-cell surface glycoprotein CD3 delta chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097367	0.973	carbohydrate derivative binding
GO:0008289	0.971	lipid binding
GO:0001530	0.866	lipopolysaccharide binding
GO:0042802	0.856	identical protein binding
GO:0070891	0.829	lipoteichoic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.993	positive regulation of biological process
GO:0048522	0.949	positive regulation of cellular process
GO:0019222	0.928	regulation of metabolic process
GO:0009987	0.927	cellular process
GO:0050896	0.920	response to stimulus
GO:0010604	0.915	positive regulation of macromolecule metabolic process
GO:0032501	0.740	multicellular organismal process
GO:0030155	0.732	regulation of cell adhesion
GO:0002376	0.684	immune system process
GO:0051716	0.669	cellular response to stimulus
GO:0002682	0.666	regulation of immune system process
GO:0002684	0.661	positive regulation of immune system process
GO:0050865	0.655	regulation of cell activation
GO:0007165	0.576	signal transduction
GO:0002694	0.566	regulation of leukocyte activation
GO:0051240	0.554	positive regulation of multicellular organismal process
GO:0051249	0.539	regulation of lymphocyte activation
GO:0045321	0.519	leukocyte activation
GO:0022407	0.486	regulation of cell-cell adhesion
GO:0006955	0.471	immune response
GO:0050863	0.459	regulation of T cell activation
GO:0002696	0.457	positive regulation of leukocyte activation
GO:1903037	0.455	regulation of leukocyte cell-cell adhesion
GO:0007166	0.410	cell surface receptor signaling pathway
GO:0006950	0.387	response to stress
GO:0031323	0.382	regulation of cellular metabolic process
GO:0080090	0.381	regulation of primary metabolic process
GO:0046649	0.367	lymphocyte activation
GO:0042127	0.359	regulation of cell population proliferation
GO:0010468	0.337	regulation of gene expression
GO:0051171	0.323	regulation of nitrogen compound metabolic process
GO:0045785	0.318	positive regulation of cell adhesion
GO:0051251	0.301	positive regulation of lymphocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.986	protein-containing complex
GO:0005622	0.930	intracellular anatomical structure
GO:0043235	0.866	receptor complex
GO:0098796	0.852	membrane protein complex
GO:0098797	0.843	plasma membrane protein complex
GO:0098802	0.789	plasma membrane signaling receptor complex
GO:0042101	0.761	T cell receptor complex
GO:0043227	0.757	membrane-bounded organelle
GO:0005737	0.750	cytoplasm
GO:0043231	0.742	intracellular membrane-bounded organelle
GO:0001772	0.733	immunological synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]