StarFunc result for job id P30273

User Input

>input (86 residues)
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
SDGVYTGLSTRNQETYETLKHEKPPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07549	0.357	0.252	4.328E-1	140	0.151	0.093	Q07549.pdb.gz	SNA4_YEAST Protein SNA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNA4 PE=1 SV=1
2	AFDB:P59646	0.348	0.340	9.064E-1	89	0.209	0.202	P59646.pdb.gz	FXYD4_HUMAN FXYD domain-containing ion transport regulator 4 OS=Homo sapiens OX=9606 GN=FXYD4 PE=3 SV=2
3	AFDB:P20396	0.302	0.136	9.840E-1	242	0.163	0.058	P20396.pdb.gz	TRH_HUMAN Pro-thyrotropin-releasing hormone OS=Homo sapiens OX=9606 GN=TRH PE=1 SV=1
4	AFDB:P18564	0.494	0.064	1.259	788	0.140	0.015	P18564.pdb.gz	ITB6_HUMAN Integrin beta-6 OS=Homo sapiens OX=9606 GN=ITGB6 PE=1 SV=2
5	AFDB:O04547	0.330	0.247	1.367	118	0.128	0.093	O04547.pdb.gz	CLE26_ARATH CLAVATA3/ESR (CLE)-related protein 26 OS=Arabidopsis thaliana OX=3702 GN=CLE26 PE=3 SV=1
6	AFDB:Q9VUL9	0.378	0.091	1.899	503	0.140	0.024	Q9VUL9.pdb.gz	FUCTA_DROME Glycoprotein 3-alpha-L-fucosyltransferase A OS=Drosophila melanogaster OX=7227 GN=FucTA PE=1 SV=2
7	AFDB:D4A100	0.457	0.379	2.061	107	0.174	0.140	D4A100.pdb.gz	D4A100_RAT Stomatin (Epb7.2)-like 3 OS=Rattus norvegicus OX=10116 GN=Stoml3 PE=1 SV=3
8	PDB:7qsdd	0.337	0.259	2.095	120	0.151	0.108	7qsdd.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.
9	AFDB:Q38AY8	0.349	0.089	2.238	499	0.151	0.026	Q38AY8.pdb.gz	Q38AY8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0640 PE=4 SV=1
10	AFDB:Q5B5C1	0.409	0.097	2.863	459	0.116	0.022	Q5B5C1.pdb.gz	EIF3M_EMENI Eukaryotic translation initiation factor 3 subunit M OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN4259 PE=3 SV=1
11	AFDB:A0A0B4KFR7	0.468	0.131	3.374	373	0.128	0.029	A0A0B4KFR7.pdb.gz	A0A0B4KFR7_DROME Amphiphysin, isoform C OS=Drosophila melanogaster OX=7227 GN=Amph PE=1 SV=1
12	PDB:5xtcg	0.319	0.248	3.724	119	0.163	0.118	5xtcg.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
13	PDB:6tedR	0.259	0.120	4.388	244	0.198	0.070	6tedR.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
14	PDB:6ah0u	0.355	0.251	4.764	124	0.070	0.048	6ah0u.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
15	PDB:7mqaSS	0.278	0.087	7.799	350	0.105	0.026	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:5ifwB	0.220	0.031	9.191	702	0.058	0.007	5ifwB.pdb.gz	Quantitative interaction mapping reveals an extended UBX domain in ASPL that disrupts functional p97 hexamers.
17	PDB:2p01A	0.339	0.105	9.978	323	0.151	0.040	2p01A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30273	3.22e-57	172	86	1.000	1.000	FCERG_HUMAN High affinity immunoglobulin epsilon receptor subunit gamma OS=Homo sapiens OX=9606 GN=FCER1G PE=1 SV=1
2	P20411	5.49e-52	159	86	0.907	0.907	FCERG_RAT High affinity immunoglobulin epsilon receptor subunit gamma OS=Rattus norvegicus OX=10116 GN=Fcer1g PE=1 SV=1
3	P20491	7.65e-51	156	86	0.884	0.884	FCERG_MOUSE High affinity immunoglobulin epsilon receptor subunit gamma OS=Mus musculus OX=10090 GN=Fcer1g PE=1 SV=1
4	Q8AY96	1.38e-21	82.4	87	0.477	0.471	Q8AY96_ICTPU High affinity immunoglobulin epsilon receptor subunit gamma OS=Ictalurus punctatus OX=7998 GN=fcer1gl PE=2 SV=1
5	Q4V7G0	5.37e-10	54.7	164	0.349	0.183	Q4V7G0_RAT T-cell surface glycoprotein CD3 zeta chain OS=Rattus norvegicus OX=10116 GN=Cd247 PE=1 SV=1
6	M0R576	7.82e-10	54.7	201	0.349	0.149	M0R576_RAT T-cell surface glycoprotein CD3 zeta chain OS=Rattus norvegicus OX=10116 GN=Cd247 PE=1 SV=2
7	P20963	1.01e-09	53.9	164	0.337	0.177	CD3Z_HUMAN T-cell surface glycoprotein CD3 zeta chain OS=Homo sapiens OX=9606 GN=CD247 PE=1 SV=2
8	P24161	1.04e-08	51.2	164	0.267	0.140	CD3Z_MOUSE T-cell surface glycoprotein CD3 zeta chain OS=Mus musculus OX=10090 GN=Cd247 PE=1 SV=1
9	Q45UC9	3.77e-06	43.9	132	0.244	0.159	Q45UC9_ICTPU CD247 antigen like precursor OS=Ictalurus punctatus OX=7998 GN=cd247l PE=2 SV=1
10	P26725	1.9	28.9	428	0.140	0.028	YUR1_YEAST Probable mannosyltransferase YUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YUR1 PE=1 SV=1
11	G5EEU2	5.9	27.7	714	0.128	0.015	SET25_CAEEL Histone-lysine N-methyltransferase set-25 OS=Caenorhabditis elegans OX=6239 GN=set-25 PE=1 SV=1
12	Q7TNK1	9.8	26.9	735	0.128	0.015	RFX4_MOUSE Transcription factor RFX4 OS=Mus musculus OX=10090 GN=Rfx4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02189 ITAM	0.0087	27.6	Immunoreceptor tyrosine-based activation motif
2	PF05002 SGS	6.5e+02	11.9	SGS domain
3	PF11628 TCR_zetazeta	1.6e-13	61.5	T-cell surface glycoprotein CD3 zeta chain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289902

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308782	0.999	Platelet glycoprotein VI
2	9606.ENSP00000364907	0.999	Tyrosine-protein kinase SYK
3	9606.ENSP00000357097	0.993	High affinity immunoglobulin epsilon receptor subunit alpha
4	9606.ENSP00000291759	0.991	Leukocyte immunoglobulin-like receptor subfamily A member 4
5	9606.ENSP00000291890	0.991	Natural cytotoxicity triggering receptor 1
6	9606.ENSP00000262629	0.981	TYRO protein tyrosine kinase-binding protein
7	9606.ENSP00000356946	0.980	Low affinity immunoglobulin gamma Fc region receptor III-A
8	9606.ENSP00000299663	0.979	C-type lectin domain family 4 member E
9	9606.ENSP00000351497	0.976	Low affinity immunoglobulin gamma Fc region receptor II-b
10	9606.ENSP00000428924	0.975	Tyrosine-protein kinase Lyn
11	9606.ENSP00000046794	0.969	Lymphocyte cytosolic protein 2
12	9606.ENSP00000358165	0.968	High affinity immunoglobulin gamma Fc receptor I
13	9606.ENSP00000483570	0.961	Tyrosine-protein kinase BTK
14	9606.ENSP00000472929	0.959	Proto-oncogene vav
15	9606.ENSP00000433642	0.956	Low affinity immunoglobulin gamma Fc region receptor III-B
16	9606.ENSP00000346671	0.951	Tyrosine-protein kinase Fyn
17	9606.ENSP00000371505	0.950	C-type lectin domain family 6 member A
18	9606.ENSP00000340944	0.948	Tyrosine-protein phosphatase non-receptor type 11
19	9606.ENSP00000440428	0.947	C-type lectin domain family 4 member C
20	9606.ENSP00000354952	0.946	GRB2-associated-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	0.999	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.998	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0007166	0.988	cell surface receptor signaling pathway
GO:0002764	0.985	immune response-regulating signaling pathway
GO:0002768	0.980	immune response-regulating cell surface receptor signaling pathway
GO:0048518	0.866	positive regulation of biological process
GO:0002376	0.636	immune system process
GO:0048522	0.554	positive regulation of cellular process
GO:0048584	0.535	positive regulation of response to stimulus
GO:0002684	0.475	positive regulation of immune system process
GO:0050778	0.466	positive regulation of immune response
GO:0032501	0.409	multicellular organismal process
GO:0051239	0.359	regulation of multicellular organismal process
GO:0019222	0.358	regulation of metabolic process
GO:0006950	0.350	response to stress
GO:0048519	0.345	negative regulation of biological process
GO:0060255	0.336	regulation of macromolecule metabolic process
GO:0009893	0.307	positive regulation of metabolic process
GO:0002757	0.302	immune response-activating signaling pathway
GO:0042221	0.300	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0098796	0.996	membrane protein complex
GO:0012505	0.995	endomembrane system
GO:0098797	0.991	plasma membrane protein complex
GO:0005622	0.979	intracellular anatomical structure
GO:0031982	0.962	vesicle
GO:0005737	0.961	cytoplasm
GO:0031410	0.954	cytoplasmic vesicle
GO:0031090	0.940	organelle membrane
GO:0012506	0.869	vesicle membrane
GO:0030659	0.790	cytoplasmic vesicle membrane
GO:0098588	0.787	bounding membrane of organelle
GO:0030141	0.772	secretory granule
GO:0009986	0.560	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]