StarFunc result for job id P30279

User Input

>input (289 residues)
MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKH
AQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDV
DCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30279	1.000	1.000	1.481E-39	289	1.000	1.000	P30279.pdb.gz	CCND2_HUMAN G1/S-specific cyclin-D2 OS=Homo sapiens OX=9606 GN=CCND2 PE=1 SV=1
2	AFDB:P50755	0.931	0.925	1.330E-25	291	0.637	0.632	P50755.pdb.gz	CCND1_XENLA G1/S-specific cyclin-D1 OS=Xenopus laevis OX=8355 GN=ccnd1 PE=1 SV=1
3	AFDB:Q90459	0.877	0.871	5.386E-25	291	0.623	0.619	Q90459.pdb.gz	CCND1_DANRE G1/S-specific cyclin-D1 OS=Danio rerio OX=7955 GN=ccnd1 PE=2 SV=1
4	AFDB:P24385	0.881	0.864	5.878E-25	295	0.626	0.614	P24385.pdb.gz	CCND1_HUMAN G1/S-specific cyclin-D1 OS=Homo sapiens OX=9606 GN=CCND1 PE=1 SV=1
5	AFDB:P48961	0.844	0.832	3.377E-24	293	0.585	0.577	P48961.pdb.gz	CCND3_RAT G1/S-specific cyclin-D3 OS=Rattus norvegicus OX=10116 GN=Ccnd3 PE=1 SV=1
6	PDB:2w96A	0.794	0.918	1.500E-21	249	0.543	0.631	2w96A.pdb.gz
7	PDB:3g33B	0.767	0.965	2.535E-21	229	0.536	0.677	3g33B.pdb.gz
8	AFDB:A3KPA9	0.813	0.731	1.034E-15	323	0.388	0.347	A3KPA9.pdb.gz	A3KPA9_DANRE LOC567411 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC567411 PE=2 SV=1
9	AFDB:Q9GTQ8	0.807	0.494	1.747E-15	481	0.353	0.212	Q9GTQ8.pdb.gz	Q9GTQ8_DROME Cyclin D OS=Drosophila melanogaster OX=7227 GN=CycD PE=2 SV=1
10	AFDB:Q9U2M5	0.764	0.554	6.110E-13	405	0.235	0.168	Q9U2M5.pdb.gz	CCND_CAEEL G1/S-specific cyclin-D OS=Caenorhabditis elegans OX=6239 GN=cyd-1 PE=1 SV=1
11	PDB:1g3nC	0.707	0.869	3.187E-11	233	0.253	0.313	1g3nC.pdb.gz
12	AFDB:Q147G5	0.723	0.488	1.322E-10	436	0.239	0.158	Q147G5.pdb.gz	CCA22_ARATH Cyclin-A2-2 OS=Arabidopsis thaliana OX=3702 GN=CYCA2-2 PE=2 SV=1
13	AFDB:P43449	0.736	0.548	1.442E-10	395	0.246	0.180	P43449.pdb.gz	CCNA2_CHICK Cyclin-A2 OS=Gallus gallus OX=9031 GN=CCNA2 PE=1 SV=1
14	PDB:7b5lY	0.685	0.776	4.651E-9	253	0.232	0.265	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
15	PDB:7nj0C	0.712	0.759	1.387E-8	270	0.183	0.196	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
16	PDB:7kpvB	0.588	0.586	4.922E-5	290	0.159	0.159	7kpvB.pdb.gz
17	PDB:7egb9	0.441	0.443	9.077E-5	287	0.159	0.160	7egb9.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
18	PDB:5hbhB	0.482	0.513	1.674E-4	270	0.145	0.156	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
19	PDB:1zp2A	0.557	0.688	1.908E-4	227	0.138	0.176	1zp2A.pdb.gz
20	PDB:6gzhB	0.557	0.628	2.828E-4	252	0.135	0.155	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30279	0.0	595	289	1.000	1.000	CCND2_HUMAN G1/S-specific cyclin-D2 OS=Homo sapiens OX=9606 GN=CCND2 PE=1 SV=1
2	P30280	0.0	543	289	0.920	0.920	CCND2_MOUSE G1/S-specific cyclin-D2 OS=Mus musculus OX=10090 GN=Ccnd2 PE=1 SV=1
3	Q04827	0.0	549	288	0.924	0.927	CCND2_RAT G1/S-specific cyclin-D2 OS=Rattus norvegicus OX=10116 GN=Ccnd2 PE=1 SV=1
4	Q90459	1.72e-127	366	291	0.623	0.619	CCND1_DANRE G1/S-specific cyclin-D1 OS=Danio rerio OX=7955 GN=ccnd1 PE=2 SV=1
5	P30281	4.51e-125	360	292	0.633	0.627	CCND3_HUMAN G1/S-specific cyclin-D3 OS=Homo sapiens OX=9606 GN=CCND3 PE=1 SV=2
6	P50755	2.30e-124	358	291	0.637	0.632	CCND1_XENLA G1/S-specific cyclin-D1 OS=Xenopus laevis OX=8355 GN=ccnd1 PE=1 SV=1
7	P30282	3.12e-122	353	292	0.626	0.620	CCND3_MOUSE G1/S-specific cyclin-D3 OS=Mus musculus OX=10090 GN=Ccnd3 PE=1 SV=1
8	P48961	7.60e-121	349	293	0.623	0.614	CCND3_RAT G1/S-specific cyclin-D3 OS=Rattus norvegicus OX=10116 GN=Ccnd3 PE=1 SV=1
9	Q6GLD3	2.55e-120	348	291	0.633	0.629	Q6GLD3_XENTR Cyclin D1 OS=Xenopus tropicalis OX=8364 GN=ccnd1 PE=1 SV=1
10	P25322	2.38e-116	338	295	0.623	0.610	CCND1_MOUSE G1/S-specific cyclin-D1 OS=Mus musculus OX=10090 GN=Ccnd1 PE=1 SV=1
11	P39948	4.96e-116	337	295	0.619	0.607	CCND1_RAT G1/S-specific cyclin-D1 OS=Rattus norvegicus OX=10116 GN=Ccnd1 PE=2 SV=1
12	P24385	7.35e-111	324	295	0.626	0.614	CCND1_HUMAN G1/S-specific cyclin-D1 OS=Homo sapiens OX=9606 GN=CCND1 PE=1 SV=1
13	Q6FI00	7.35e-111	324	295	0.626	0.614	Q6FI00_HUMAN CCND1 protein OS=Homo sapiens OX=9606 GN=CCND1 PE=2 SV=1
14	D3GDI9	2.21e-55	182	297	0.367	0.357	D3GDI9_DANRE Cyclin Dx OS=Danio rerio OX=7955 GN=im:7162084 PE=2 SV=1
15	A3KPA9	5.06e-55	182	323	0.367	0.328	A3KPA9_DANRE LOC567411 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC567411 PE=2 SV=1
16	Q24158	3.07e-49	171	452	0.329	0.210	Q24158_DROME Cyclin D (Fragment) OS=Drosophila melanogaster OX=7227 GN=CycD PE=2 SV=1
17	Q9GTQ8	4.49e-49	171	481	0.329	0.198	Q9GTQ8_DROME Cyclin D OS=Drosophila melanogaster OX=7227 GN=CycD PE=2 SV=1
18	Q7KUZ5	4.98e-49	171	477	0.329	0.199	Q7KUZ5_DROME Cyclin D, isoform D OS=Drosophila melanogaster OX=7227 GN=CycD PE=3 SV=1
19	Q9VXM1	4.98e-49	171	481	0.329	0.198	Q9VXM1_DROME LD22957p OS=Drosophila melanogaster OX=7227 GN=CycD PE=2 SV=1
20	Q9U2M5	8.28e-30	118	405	0.221	0.158	CCND_CAEEL G1/S-specific cyclin-D OS=Caenorhabditis elegans OX=6239 GN=cyd-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02984 Cyclin_C	1.1e-17	75.6	Cyclin, C-terminal domain
2	PF00134 Cyclin_N	9.9e-35	130.5	Cyclin, N-terminal domain
3	PF09080 K-cyclin_vir_C	9.2	18.1	K cyclin, C terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261254

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257904	0.999	Cyclin-dependent kinase 4
2	9606.ENSP00000265734	0.999	Cyclin-dependent kinase 6
3	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
4	9606.ENSP00000384849	0.996	Cyclin-dependent kinase inhibitor 1
5	9606.ENSP00000228872	0.993	Cyclin-dependent kinase inhibitor 1B
6	9606.ENSP00000262133	0.992	Retinoblastoma-like protein 2
7	9606.ENSP00000267163	0.992	Retinoblastoma-associated protein
8	9606.ENSP00000418915	0.990	Cyclin-dependent kinase inhibitor 2A
9	9606.ENSP00000378699	0.983	Cyclin-dependent kinase 1
10	9606.ENSP00000413720	0.977	Cyclin-dependent kinase inhibitor 1C
11	9606.ENSP00000368686	0.971	Transcription factor E2F4
12	9606.ENSP00000362768	0.969	Retinoblastoma-like protein 1
13	9606.ENSP00000398124	0.964	Transcription factor E2F5
14	9606.ENSP00000262662	0.963	Cyclin-dependent kinase 4 inhibitor C
15	9606.ENSP00000355249	0.963	Transcription factor E2F2
16	9606.ENSP00000262904	0.962	Transcription factor E2F3
17	9606.ENSP00000256443	0.959	Cyclin-dependent kinase 7
18	9606.ENSP00000276925	0.959	Cyclin-dependent kinase 4 inhibitor B
19	9606.ENSP00000345571	0.956	Transcription factor E2F1
20	9606.ENSP00000256897	0.953	Cyclin-H

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.999	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0009987	0.986	cellular process
GO:0048522	0.981	positive regulation of cellular process
GO:0019222	0.975	regulation of metabolic process
GO:0051726	0.973	regulation of cell cycle
GO:0042127	0.972	regulation of cell population proliferation
GO:0080090	0.971	regulation of primary metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0060255	0.967	regulation of macromolecule metabolic process
GO:0031323	0.966	regulation of cellular metabolic process
GO:0032501	0.962	multicellular organismal process
GO:0048519	0.953	negative regulation of biological process
GO:0009893	0.950	positive regulation of metabolic process
GO:0051716	0.934	cellular response to stimulus
GO:0010604	0.929	positive regulation of macromolecule metabolic process
GO:0051173	0.913	positive regulation of nitrogen compound metabolic process
GO:0048523	0.910	negative regulation of cellular process
GO:0051246	0.884	regulation of protein metabolic process
GO:0032502	0.869	developmental process
GO:0031325	0.863	positive regulation of cellular metabolic process
GO:0048856	0.859	anatomical structure development
GO:0051247	0.854	positive regulation of protein metabolic process
GO:0008284	0.850	positive regulation of cell population proliferation
GO:0043549	0.848	regulation of kinase activity
GO:0009889	0.841	regulation of biosynthetic process
GO:0045859	0.835	regulation of protein kinase activity
GO:0031401	0.832	positive regulation of protein modification process
GO:0071900	0.822	regulation of protein serine/threonine kinase activity
GO:0044770	0.819	cell cycle phase transition
GO:0010468	0.819	regulation of gene expression
GO:1901987	0.819	regulation of cell cycle phase transition
GO:1904029	0.811	regulation of cyclin-dependent protein kinase activity
GO:0007154	0.806	cell communication
GO:0042327	0.805	positive regulation of phosphorylation
GO:1901990	0.802	regulation of mitotic cell cycle phase transition
GO:0010556	0.799	regulation of macromolecule biosynthetic process
GO:0031326	0.794	regulation of cellular biosynthetic process
GO:0019219	0.792	regulation of nucleobase-containing compound metabolic process
GO:0044772	0.778	mitotic cell cycle phase transition
GO:0007275	0.773	multicellular organism development
GO:0044093	0.765	positive regulation of molecular function
GO:0010941	0.753	regulation of cell death
GO:0023052	0.749	signaling
GO:0000079	0.749	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0043085	0.743	positive regulation of catalytic activity
GO:2000045	0.736	regulation of G1/S transition of mitotic cell cycle
GO:0001934	0.721	positive regulation of protein phosphorylation
GO:0010212	0.707	response to ionizing radiation
GO:0043066	0.702	negative regulation of apoptotic process
GO:0048731	0.699	system development
GO:0042221	0.698	response to chemical
GO:0008152	0.692	metabolic process
GO:0051094	0.692	positive regulation of developmental process
GO:0045787	0.679	positive regulation of cell cycle
GO:0051347	0.676	positive regulation of transferase activity
GO:0048513	0.674	animal organ development
GO:1901700	0.671	response to oxygen-containing compound
GO:0051384	0.658	response to glucocorticoid
GO:0051252	0.612	regulation of RNA metabolic process
GO:1901654	0.601	response to ketone
GO:0033674	0.600	positive regulation of kinase activity
GO:0071704	0.582	organic substance metabolic process
GO:1901698	0.566	response to nitrogen compound
GO:1903506	0.561	regulation of nucleic acid-templated transcription
GO:0009892	0.560	negative regulation of metabolic process
GO:0007165	0.546	signal transduction
GO:0045860	0.534	positive regulation of protein kinase activity
GO:0044238	0.520	primary metabolic process
GO:0090068	0.499	positive regulation of cell cycle process
GO:0006950	0.494	response to stress
GO:0006355	0.492	regulation of DNA-templated transcription
GO:0006807	0.486	nitrogen compound metabolic process
GO:0071902	0.476	positive regulation of protein serine/threonine kinase activity
GO:0010605	0.465	negative regulation of macromolecule metabolic process
GO:0031324	0.464	negative regulation of cellular metabolic process
GO:0006357	0.461	regulation of transcription by RNA polymerase II
GO:0051172	0.456	negative regulation of nitrogen compound metabolic process
GO:0044237	0.452	cellular metabolic process
GO:0045931	0.450	positive regulation of mitotic cell cycle
GO:1901989	0.450	positive regulation of cell cycle phase transition
GO:0043170	0.428	macromolecule metabolic process
GO:0051239	0.413	regulation of multicellular organismal process
GO:1901992	0.412	positive regulation of mitotic cell cycle phase transition
GO:0070887	0.404	cellular response to chemical stimulus
GO:0007610	0.347	behavior
GO:0023051	0.345	regulation of signaling
GO:0010646	0.344	regulation of cell communication
GO:0048583	0.338	regulation of response to stimulus
GO:0009891	0.326	positive regulation of biosynthetic process
GO:0031328	0.318	positive regulation of cellular biosynthetic process
GO:0009890	0.315	negative regulation of biosynthetic process
GO:0010557	0.314	positive regulation of macromolecule biosynthetic process
GO:0031327	0.311	negative regulation of cellular biosynthetic process
GO:0010558	0.309	negative regulation of macromolecule biosynthetic process
GO:0009966	0.306	regulation of signal transduction
GO:0051254	0.303	positive regulation of RNA metabolic process
GO:0044843	0.301	cell cycle G1/S phase transition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.998	cytoplasm
GO:0031981	0.989	nuclear lumen
GO:0032991	0.981	protein-containing complex
GO:0005654	0.977	nucleoplasm
GO:0005829	0.936	cytosol
GO:1902494	0.868	catalytic complex
GO:1990234	0.853	transferase complex
GO:0061695	0.671	transferase complex, transferring phosphorus-containing groups
GO:1902554	0.645	serine/threonine protein kinase complex
GO:0000307	0.644	cyclin-dependent protein kinase holoenzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]