StarFunc result for job id P30281

User Input

>input (292 residues)
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCL
RACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48961	0.903	0.900	2.503E-35	293	0.932	0.928	P48961.pdb.gz	CCND3_RAT G1/S-specific cyclin-D3 OS=Rattus norvegicus OX=10116 GN=Ccnd3 PE=1 SV=1
2	PDB:3g33B	0.768	0.976	2.191E-26	229	0.777	0.991	3g33B.pdb.gz
3	AFDB:P30279	0.869	0.878	2.122E-25	289	0.620	0.626	P30279.pdb.gz	CCND2_HUMAN G1/S-specific cyclin-D2 OS=Homo sapiens OX=9606 GN=CCND2 PE=1 SV=1
4	AFDB:P50755	0.882	0.885	1.846E-23	291	0.545	0.546	P50755.pdb.gz	CCND1_XENLA G1/S-specific cyclin-D1 OS=Xenopus laevis OX=8355 GN=ccnd1 PE=1 SV=1
5	AFDB:Q90459	0.869	0.872	8.302E-23	291	0.521	0.522	Q90459.pdb.gz	CCND1_DANRE G1/S-specific cyclin-D1 OS=Danio rerio OX=7955 GN=ccnd1 PE=2 SV=1
6	AFDB:P24385	0.878	0.869	1.923E-22	295	0.517	0.512	P24385.pdb.gz	CCND1_HUMAN G1/S-specific cyclin-D1 OS=Homo sapiens OX=9606 GN=CCND1 PE=1 SV=1
7	PDB:2w96A	0.775	0.905	4.556E-20	249	0.462	0.542	2w96A.pdb.gz
8	AFDB:Q9GTQ8	0.778	0.478	7.790E-17	481	0.377	0.229	Q9GTQ8.pdb.gz	Q9GTQ8_DROME Cyclin D OS=Drosophila melanogaster OX=7227 GN=CycD PE=2 SV=1
9	AFDB:A3KPA9	0.779	0.706	9.267E-16	323	0.339	0.307	A3KPA9.pdb.gz	A3KPA9_DANRE LOC567411 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC567411 PE=2 SV=1
10	AFDB:Q9U2M5	0.767	0.561	1.781E-12	405	0.233	0.168	Q9U2M5.pdb.gz	CCND_CAEEL G1/S-specific cyclin-D OS=Caenorhabditis elegans OX=6239 GN=cyd-1 PE=1 SV=1
11	AFDB:Q61456	0.711	0.503	2.119E-11	421	0.247	0.171	Q61456.pdb.gz	CCNA1_MOUSE Cyclin-A1 OS=Mus musculus OX=10090 GN=Ccna1 PE=1 SV=2
12	AFDB:Q6NV43	0.720	0.497	2.119E-11	428	0.243	0.166	Q6NV43.pdb.gz	Q6NV43_DANRE Cyclin-A2 OS=Danio rerio OX=7955 GN=chunp6924 PE=2 SV=2
13	PDB:1g3nC	0.718	0.893	3.247E-11	233	0.247	0.309	1g3nC.pdb.gz
14	PDB:7nj0C	0.716	0.771	1.662E-9	270	0.195	0.211	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
15	PDB:7b5lY	0.678	0.778	3.524E-9	253	0.233	0.269	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
16	PDB:7kpvB	0.540	0.543	2.139E-5	290	0.113	0.114	7kpvB.pdb.gz
17	PDB:5hbhB	0.470	0.505	3.047E-5	270	0.134	0.144	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
18	PDB:1zp2A	0.555	0.692	3.328E-5	227	0.127	0.163	1zp2A.pdb.gz
19	PDB:6gzhB	0.573	0.652	1.432E-4	252	0.116	0.135	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
20	PDB:7jv7B	0.502	0.476	1.432E-4	310	0.099	0.094	7jv7B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30281	0.0	597	292	1.000	1.000	CCND3_HUMAN G1/S-specific cyclin-D3 OS=Homo sapiens OX=9606 GN=CCND3 PE=1 SV=2
2	P30282	0.0	566	292	0.945	0.945	CCND3_MOUSE G1/S-specific cyclin-D3 OS=Mus musculus OX=10090 GN=Ccnd3 PE=1 SV=1
3	P48961	0.0	553	293	0.932	0.928	CCND3_RAT G1/S-specific cyclin-D3 OS=Rattus norvegicus OX=10116 GN=Ccnd3 PE=1 SV=1
4	P30280	2.90e-126	363	289	0.623	0.630	CCND2_MOUSE G1/S-specific cyclin-D2 OS=Mus musculus OX=10090 GN=Ccnd2 PE=1 SV=1
5	Q04827	3.46e-125	360	288	0.623	0.632	CCND2_RAT G1/S-specific cyclin-D2 OS=Rattus norvegicus OX=10116 GN=Ccnd2 PE=1 SV=1
6	P30279	4.56e-125	360	289	0.627	0.633	CCND2_HUMAN G1/S-specific cyclin-D2 OS=Homo sapiens OX=9606 GN=CCND2 PE=1 SV=1
7	Q90459	1.95e-106	313	291	0.545	0.546	CCND1_DANRE G1/S-specific cyclin-D1 OS=Danio rerio OX=7955 GN=ccnd1 PE=2 SV=1
8	P50755	1.06e-104	308	291	0.545	0.546	CCND1_XENLA G1/S-specific cyclin-D1 OS=Xenopus laevis OX=8355 GN=ccnd1 PE=1 SV=1
9	Q6GLD3	4.32e-103	304	291	0.548	0.550	Q6GLD3_XENTR Cyclin D1 OS=Xenopus tropicalis OX=8364 GN=ccnd1 PE=1 SV=1
10	P39948	9.12e-97	288	295	0.527	0.522	CCND1_RAT G1/S-specific cyclin-D1 OS=Rattus norvegicus OX=10116 GN=Ccnd1 PE=2 SV=1
11	P25322	6.92e-96	286	295	0.524	0.519	CCND1_MOUSE G1/S-specific cyclin-D1 OS=Mus musculus OX=10090 GN=Ccnd1 PE=1 SV=1
12	P24385	1.65e-91	275	295	0.524	0.519	CCND1_HUMAN G1/S-specific cyclin-D1 OS=Homo sapiens OX=9606 GN=CCND1 PE=1 SV=1
13	Q6FI00	1.65e-91	275	295	0.524	0.519	Q6FI00_HUMAN CCND1 protein OS=Homo sapiens OX=9606 GN=CCND1 PE=2 SV=1
14	D3GDI9	2.57e-49	167	297	0.370	0.364	D3GDI9_DANRE Cyclin Dx OS=Danio rerio OX=7955 GN=im:7162084 PE=2 SV=1
15	A3KPA9	7.42e-49	167	323	0.370	0.334	A3KPA9_DANRE LOC567411 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC567411 PE=2 SV=1
16	Q24158	5.58e-48	167	452	0.346	0.223	Q24158_DROME Cyclin D (Fragment) OS=Drosophila melanogaster OX=7227 GN=CycD PE=2 SV=1
17	Q9GTQ8	6.33e-48	168	481	0.349	0.212	Q9GTQ8_DROME Cyclin D OS=Drosophila melanogaster OX=7227 GN=CycD PE=2 SV=1
18	Q7KUZ5	6.81e-48	168	477	0.349	0.214	Q7KUZ5_DROME Cyclin D, isoform D OS=Drosophila melanogaster OX=7227 GN=CycD PE=3 SV=1
19	Q9VXM1	7.10e-48	168	481	0.349	0.212	Q9VXM1_DROME LD22957p OS=Drosophila melanogaster OX=7227 GN=CycD PE=2 SV=1
20	Q9U2M5	5.62e-25	105	405	0.250	0.180	CCND_CAEEL G1/S-specific cyclin-D OS=Caenorhabditis elegans OX=6239 GN=cyd-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02984 Cyclin_C	2.1e-15	68.3	Cyclin, C-terminal domain
2	PF00134 Cyclin_N	1.2e-32	123.7	Cyclin, N-terminal domain
3	PF09080 K-cyclin_vir_C	29	16.5	K cyclin, C terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362082

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257904	0.999	Cyclin-dependent kinase 4
2	9606.ENSP00000265734	0.999	Cyclin-dependent kinase 6
3	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
4	9606.ENSP00000384849	0.996	Cyclin-dependent kinase inhibitor 1
5	9606.ENSP00000228872	0.994	Cyclin-dependent kinase inhibitor 1B
6	9606.ENSP00000262133	0.992	Retinoblastoma-like protein 2
7	9606.ENSP00000378699	0.990	Cyclin-dependent kinase 1
8	9606.ENSP00000464036	0.990	Cyclin-dependent kinase 11B
9	9606.ENSP00000267163	0.989	Retinoblastoma-associated protein
10	9606.ENSP00000262662	0.988	Cyclin-dependent kinase 4 inhibitor C
11	9606.ENSP00000413720	0.977	Cyclin-dependent kinase inhibitor 1C
12	9606.ENSP00000369390	0.974	Cyclin-dependent kinase 14
13	9606.ENSP00000362768	0.970	Retinoblastoma-like protein 1
14	9606.ENSP00000368686	0.967	Transcription factor E2F4
15	9606.ENSP00000398124	0.964	Transcription factor E2F5
16	9606.ENSP00000355249	0.963	Transcription factor E2F2
17	9606.ENSP00000262904	0.962	Transcription factor E2F3
18	9606.ENSP00000256897	0.961	Cyclin-H
19	9606.ENSP00000261845	0.960	Mitogen-activated protein kinase 6
20	9606.ENSP00000418915	0.959	Cyclin-dependent kinase inhibitor 2A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0003824	0.315	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0031323	0.992	regulation of cellular metabolic process
GO:0009987	0.991	cellular process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0080090	0.982	regulation of primary metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0050896	0.976	response to stimulus
GO:0048522	0.939	positive regulation of cellular process
GO:0010468	0.938	regulation of gene expression
GO:0051726	0.932	regulation of cell cycle
GO:0042127	0.916	regulation of cell population proliferation
GO:0010604	0.897	positive regulation of macromolecule metabolic process
GO:0045859	0.895	regulation of protein kinase activity
GO:0008152	0.892	metabolic process
GO:0048519	0.873	negative regulation of biological process
GO:0019219	0.870	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.864	regulation of cellular biosynthetic process
GO:0071704	0.850	organic substance metabolic process
GO:0031325	0.841	positive regulation of cellular metabolic process
GO:0007049	0.803	cell cycle
GO:0006807	0.803	nitrogen compound metabolic process
GO:0051247	0.799	positive regulation of protein metabolic process
GO:0051252	0.798	regulation of RNA metabolic process
GO:0048523	0.794	negative regulation of cellular process
GO:0010556	0.788	regulation of macromolecule biosynthetic process
GO:0043170	0.779	macromolecule metabolic process
GO:0071900	0.773	regulation of protein serine/threonine kinase activity
GO:0051716	0.771	cellular response to stimulus
GO:0022402	0.763	cell cycle process
GO:2001141	0.752	regulation of RNA biosynthetic process
GO:0044093	0.707	positive regulation of molecular function
GO:0044237	0.691	cellular metabolic process
GO:1903506	0.687	regulation of nucleic acid-templated transcription
GO:0007154	0.679	cell communication
GO:0006355	0.668	regulation of DNA-templated transcription
GO:0044238	0.650	primary metabolic process
GO:1904029	0.650	regulation of cyclin-dependent protein kinase activity
GO:0032501	0.599	multicellular organismal process
GO:0010562	0.597	positive regulation of phosphorus metabolic process
GO:0031401	0.579	positive regulation of protein modification process
GO:0000278	0.546	mitotic cell cycle
GO:0023052	0.544	signaling
GO:0009892	0.542	negative regulation of metabolic process
GO:0010605	0.532	negative regulation of macromolecule metabolic process
GO:0048583	0.530	regulation of response to stimulus
GO:0031324	0.526	negative regulation of cellular metabolic process
GO:1901564	0.517	organonitrogen compound metabolic process
GO:0042221	0.512	response to chemical
GO:0023051	0.497	regulation of signaling
GO:0010646	0.495	regulation of cell communication
GO:0044770	0.482	cell cycle phase transition
GO:0042327	0.469	positive regulation of phosphorylation
GO:0051172	0.466	negative regulation of nitrogen compound metabolic process
GO:0007165	0.466	signal transduction
GO:0009966	0.427	regulation of signal transduction
GO:0000079	0.415	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0001934	0.373	positive regulation of protein phosphorylation
GO:0008283	0.362	cell population proliferation
GO:1903047	0.361	mitotic cell cycle process
GO:0032502	0.355	developmental process
GO:0043085	0.347	positive regulation of catalytic activity
GO:0006357	0.334	regulation of transcription by RNA polymerase II
GO:0048856	0.331	anatomical structure development
GO:0044772	0.326	mitotic cell cycle phase transition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0005829	0.990	cytosol
GO:0032991	0.964	protein-containing complex
GO:1902494	0.822	catalytic complex
GO:1990234	0.753	transferase complex
GO:0061695	0.685	transferase complex, transferring phosphorus-containing groups
GO:0000307	0.663	cyclin-dependent protein kinase holoenzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]