StarFunc result for job id P30291

User Input

>input (646 residues)
MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDS
PLPPARSPTEPGPERRRSPGPAPGSPGELEEDLLLPGACPGADEAGGGAEGDSWEEEGFG
SSSPVKSPAAPYFLGSSFSPVRCGGPGDASPRGCGARRAGEGRRSPRPDHPGTPPHKTFR
KLRLFDTPHTPKSLLSKARGIDSSSVKLRGSSLFMDTEKSGKREFDVRQTPQVNINPFTP
DSLLLHSSGQCRRRKRTYWNDSCGEDMEASDYELEDETRPAKRITITESNMKSRYTTEFH
ELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVV
RYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSM
SLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDS
RFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQ
EFTELLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKK
AQMAKAAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30291	1.000	1.000	4.080E-103	646	1.000	1.000	P30291.pdb.gz	WEE1_HUMAN Wee1-like protein kinase OS=Homo sapiens OX=9606 GN=WEE1 PE=1 SV=2
2	AFDB:Q9C5H5	0.370	0.335	3.427E-17	716	0.167	0.151	Q9C5H5.pdb.gz	M3K5G_ARATH Mitogen-activated protein kinase kinase kinase 5 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK5 PE=1 SV=1
3	PDB:6s73A	0.345	0.787	8.210E-16	269	0.104	0.249	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
4	PDB:4rerA	0.354	0.491	9.177E-16	459	0.102	0.144	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
5	PDB:4zhxA	0.348	0.534	1.602E-15	409	0.102	0.161	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
6	PDB:6b1uA	0.348	0.497	1.602E-15	442	0.119	0.174	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
7	PDB:7qwkH	0.325	0.768	1.791E-15	259	0.128	0.320	7qwkH.pdb.gz	The structure of human GCN2 reveals a parallel, back-to-back kinase dimer with a plastic DFG activation loop motif.
8	PDB:5u6yA	0.349	0.482	1.893E-15	459	0.108	0.153	5u6yA.pdb.gz
9	AFDB:P53349	0.360	0.163	2.498E-15	1493	0.176	0.076	P53349.pdb.gz	M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus OX=10090 GN=Map3k1 PE=1 SV=3
10	AFDB:M9PGC5	0.356	0.102	4.360E-15	2462	0.183	0.048	M9PGC5.pdb.gz	WNK_DROME Serine/threonine-protein kinase Wnk OS=Drosophila melanogaster OX=7227 GN=Wnk PE=1 SV=2
11	PDB:4rewA	0.344	0.525	4.616E-15	411	0.104	0.163	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
12	PDB:5ufuA	0.356	0.603	4.616E-15	369	0.102	0.179	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
13	PDB:4c0tA	0.352	0.737	5.160E-15	291	0.085	0.189	4c0tA.pdb.gz
14	PDB:7myjC	0.341	0.466	8.518E-15	465	0.093	0.129	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
15	AFDB:Q388H2	0.353	0.216	1.755E-14	1083	0.183	0.109	Q388H2.pdb.gz	Q388H2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2490 PE=4 SV=1
16	AFDB:Q9FGW5	0.352	0.371	2.451E-14	612	0.155	0.163	Q9FGW5.pdb.gz	CDKG1_ARATH Cyclin-dependent kinase G1 OS=Arabidopsis thaliana OX=3702 GN=CDKG1 PE=1 SV=1
17	AFDB:P18160	0.364	0.104	4.783E-14	2410	0.158	0.042	P18160.pdb.gz	SPLA_DICDI Dual specificity protein kinase splA OS=Dictyostelium discoideum OX=44689 GN=splA PE=1 SV=3
18	AFDB:Q9HFF4	0.341	0.222	6.319E-14	1023	0.172	0.109	Q9HFF4.pdb.gz	PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk1 PE=1 SV=2
19	AFDB:P48562	0.348	0.271	1.103E-13	842	0.146	0.112	P48562.pdb.gz	CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLA4 PE=1 SV=1
20	AFDB:Q57Y61	0.345	0.253	1.233E-13	899	0.186	0.133	Q57Y61.pdb.gz	Q57Y61_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.380 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PRU3	0.0	518	252	0.390	1.000	E9PRU3_HUMAN WEE1 G2 checkpoint kinase OS=Homo sapiens OX=9606 GN=WEE1 PE=1 SV=2
2	P30291	0.0	1332	646	1.000	1.000	WEE1_HUMAN Wee1-like protein kinase OS=Homo sapiens OX=9606 GN=WEE1 PE=1 SV=2
3	P47810	0.0	1126	646	0.906	0.906	WEE1_MOUSE Wee1-like protein kinase OS=Mus musculus OX=10090 GN=Wee1 PE=1 SV=2
4	Q1LYE1	0.0	743	612	0.641	0.676	Q1LYE1_DANRE Wee1-like protein kinase OS=Danio rerio OX=7955 GN=fa20h03 PE=1 SV=1
5	Q6DRI0	0.0	739	612	0.639	0.675	Q6DRI0_DANRE Wee1-like protein kinase OS=Danio rerio OX=7955 GN=fa20h03 PE=1 SV=1
6	Q8QGV2	0.0	833	595	0.703	0.763	WEE1B_XENLA Wee1-like protein kinase 1-B OS=Xenopus laevis OX=8355 GN=wee1-b PE=1 SV=1
7	P47817	1.12e-160	474	555	0.406	0.472	WEE2A_XENLA Wee1-like protein kinase 2-A OS=Xenopus laevis OX=8355 GN=wee2-a PE=1 SV=2
8	A4PES0	1.17e-149	446	565	0.385	0.441	WEE2_PIG Wee1-like protein kinase 2 OS=Sus scrofa OX=9823 GN=WEE2 PE=1 SV=2
9	P0C1S8	6.03e-149	445	567	0.381	0.434	WEE2_HUMAN Wee1-like protein kinase 2 OS=Homo sapiens OX=9606 GN=WEE2 PE=1 SV=2
10	Q66JT0	1.26e-139	420	555	0.367	0.427	WEE2_MOUSE Wee1-like protein kinase 2 OS=Mus musculus OX=10090 GN=Wee2 PE=1 SV=2
11	P54350	1.26e-125	386	609	0.330	0.350	WEE1_DROME Wee1-like protein kinase OS=Drosophila melanogaster OX=7227 GN=Wee1 PE=1 SV=2
12	H7C5P0	3.90e-75	241	203	0.180	0.571	H7C5P0_HUMAN WEE2 oocyte meiosis inhibiting kinase (Fragment) OS=Homo sapiens OX=9606 GN=WEE2 PE=1 SV=1
13	Q8L4H0	1.52e-53	193	500	0.158	0.204	WEE1_ARATH Wee1-like protein kinase OS=Arabidopsis thaliana OX=3702 GN=WEE1 PE=1 SV=1
14	E9PRI3	5.09e-43	152	99	0.119	0.778	E9PRI3_HUMAN WEE1 G2 checkpoint kinase (Fragment) OS=Homo sapiens OX=9606 GN=WEE1 PE=1 SV=1
15	Q9ESG9	8.40e-40	154	490	0.156	0.206	PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus OX=10090 GN=Pkmyt1 PE=2 SV=3
16	Q99640	1.35e-39	154	499	0.155	0.200	PMYT1_HUMAN Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens OX=9606 GN=PKMYT1 PE=1 SV=1
17	Q9NI63	1.11e-36	146	533	0.153	0.186	PMYT1_DROME Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Drosophila melanogaster OX=7227 GN=Myt1 PE=1 SV=2
18	O18209	2.76e-36	147	677	0.139	0.133	PMY13_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis elegans OX=6239 GN=wee-1.3 PE=1 SV=1
19	G5EB22	7.43e-32	134	1050	0.124	0.076	G5EB22_EMENI Protein kinase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05822 PE=4 SV=1
20	P07527	3.46e-29	126	877	0.124	0.091	WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wee1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	3.5e-57	205.4	Protein kinase domain
2	PF07714 PK_Tyr_Ser-Thr	2.2e-20	84.6	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000402084

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378699	0.998	Cyclin-dependent kinase 1
2	9606.ENSP00000256442	0.988	G2/mitotic-specific cyclin-B1
3	9606.ENSP00000274026	0.980	Cyclin-A2
4	9606.ENSP00000300093	0.979	Serine/threonine-protein kinase PLK1
5	9606.ENSP00000303706	0.967	M-phase inducer phosphatase 1
6	9606.ENSP00000262643	0.965	G1/S-specific cyclin-E1
7	9606.ENSP00000388648	0.965	Serine/threonine-protein kinase Chk1
8	9606.ENSP00000429089	0.958	G1/S-specific cyclin-E2
9	9606.ENSP00000255465	0.953	Cyclin-A1
10	9606.ENSP00000266970	0.935	Cyclin-dependent kinase 2
11	9606.ENSP00000335153	0.932	Heat shock protein HSP 90-alpha
12	9606.ENSP00000321656	0.923	M-phase inducer phosphatase 3
13	9606.ENSP00000256925	0.922	CDK5 and ABL1 enzyme substrate 1
14	9606.ENSP00000359206	0.906	F-box/WD repeat-containing protein 1A
15	9606.ENSP00000265094	0.899	F-box/WD repeat-containing protein 11
16	9606.ENSP00000245960	0.893	M-phase inducer phosphatase 2
17	9606.ENSP00000300574	0.831	Adapter molecule crk
18	9606.ENSP00000372023	0.823	Serine/threonine-protein kinase Chk2
19	9606.ENSP00000442068	0.817	Cell division cycle-associated protein 3
20	9606.ENSP00000343741	0.811	Serine/threonine-protein kinase ATR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0004674	0.893	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.990	regulation of cellular process
GO:1901987	0.918	regulation of cell cycle phase transition
GO:0007346	0.913	regulation of mitotic cell cycle
GO:0045786	0.897	negative regulation of cell cycle
GO:0008152	0.839	metabolic process
GO:0010948	0.834	negative regulation of cell cycle process
GO:1903047	0.809	mitotic cell cycle process
GO:1901988	0.805	negative regulation of cell cycle phase transition
GO:0044770	0.797	cell cycle phase transition
GO:0044772	0.791	mitotic cell cycle phase transition
GO:0019222	0.749	regulation of metabolic process
GO:1901990	0.743	regulation of mitotic cell cycle phase transition
GO:0071704	0.742	organic substance metabolic process
GO:0044237	0.734	cellular metabolic process
GO:0044238	0.730	primary metabolic process
GO:0006807	0.723	nitrogen compound metabolic process
GO:0043170	0.680	macromolecule metabolic process
GO:0060255	0.652	regulation of macromolecule metabolic process
GO:0045930	0.635	negative regulation of mitotic cell cycle
GO:1902806	0.627	regulation of cell cycle G1/S phase transition
GO:0080090	0.626	regulation of primary metabolic process
GO:0051171	0.614	regulation of nitrogen compound metabolic process
GO:0031323	0.612	regulation of cellular metabolic process
GO:0000086	0.593	G2/M transition of mitotic cell cycle
GO:0036211	0.556	protein modification process
GO:0050896	0.493	response to stimulus
GO:0071840	0.471	cellular component organization or biogenesis
GO:0016043	0.434	cellular component organization
GO:1901991	0.422	negative regulation of mitotic cell cycle phase transition
GO:0048518	0.416	positive regulation of biological process
GO:0048522	0.372	positive regulation of cellular process
GO:0051716	0.344	cellular response to stimulus
GO:0006796	0.340	phosphate-containing compound metabolic process
GO:0006996	0.309	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005737	0.962	cytoplasm
GO:0005829	0.653	cytosol
GO:0005730	0.537	nucleolus
GO:0032991	0.402	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]

[back to server]