StarFunc result for job id P30304

User Input

>input (524 residues)
MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYE
QPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALK
RSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAP
ARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASL
WTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPK
ESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYI
SPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT
DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY
CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30304	1.000	1.000	6.640E-87	524	1.000	1.000	P30304.pdb.gz	MPIP1_HUMAN M-phase inducer phosphatase 1 OS=Homo sapiens OX=9606 GN=CDC25A PE=1 SV=2
2	AFDB:P48965	0.421	0.420	1.481E-74	525	0.849	0.848	P48965.pdb.gz	MPIP1_RAT M-phase inducer phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Cdc25a PE=1 SV=1
3	PDB:3fs5A	0.187	0.568	1.620E-6	152	0.065	0.224	3fs5A.pdb.gz
4	PDB:1gmxA	0.168	0.709	1.164E-4	108	0.044	0.213	1gmxA.pdb.gz
5	PDB:3d1pA	0.172	0.659	1.242E-4	120	0.046	0.200	3d1pA.pdb.gz
6	PDB:6bevB	0.167	0.661	8.669E-4	114	0.050	0.228	6bevB.pdb.gz
7	PDB:1h4kX	0.157	0.282	1.053E-3	271	0.065	0.125	1h4kX.pdb.gz	A Persulfurated Cysteine Promotes Active Site Reactivity in Azotobacter Vinelandii Rhodanse
8	PDB:8agfA	0.143	0.245	2.782E-3	290	0.053	0.097	8agfA.pdb.gz
9	PDB:6yxxBb	0.143	0.437	4.670E-3	133	0.052	0.203	6yxxBb.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
10	PDB:2jtqA	0.125	0.642	6.456E-3	85	0.036	0.224	2jtqA.pdb.gz
11	PDB:2wlrA	0.162	0.203	7.841E-3	408	0.042	0.054	2wlrA.pdb.gz
12	PDB:3hzuA	0.159	0.262	1.234E-2	292	0.042	0.075	3hzuA.pdb.gz
13	AFDB:U4PAZ9	0.052	0.029	4.394E-1	1112	0.116	0.055	U4PAZ9.pdb.gz	PTRN1_CAEEL Patronin (microtubule-binding protein) homolog OS=Caenorhabditis elegans OX=6239 GN=ptrn-1 PE=1 SV=1
14	AFDB:Q9Y794	0.136	0.083	5.337E-1	972	0.149	0.080	Q9Y794.pdb.gz	ORC4_SCHPO Origin recognition complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc4 PE=1 SV=1
15	AFDB:F1QWY1	0.057	0.063	1.949	466	0.080	0.090	F1QWY1.pdb.gz
16	AFDB:Q59PA6	0.065	0.048	2.367	779	0.113	0.076	Q59PA6.pdb.gz	Q59PA6_CANAL Vac7p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VAC7 PE=4 SV=1
17	AFDB:Q9LUS2	0.075	0.046	2.367	1089	0.145	0.070	Q9LUS2.pdb.gz	TC120_ARATH Translocase of chloroplast 120, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC120 PE=1 SV=1
18	AFDB:F4K2E9	0.064	0.036	2.526	1255	0.113	0.047	F4K2E9.pdb.gz	PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana OX=3702 GN=CUV PE=1 SV=1
19	AFDB:Q9QY01	0.062	0.041	2.695	1037	0.113	0.057	Q9QY01.pdb.gz	ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus OX=10090 GN=Ulk2 PE=1 SV=1
20	AFDB:F1QNU4	0.063	0.056	3.974	609	0.097	0.084	F1QNU4.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30304	0.0	1083	524	1.000	1.000	MPIP1_HUMAN M-phase inducer phosphatase 1 OS=Homo sapiens OX=9606 GN=CDC25A PE=1 SV=2
2	P48964	0.0	874	514	0.842	0.858	MPIP1_MOUSE M-phase inducer phosphatase 1 OS=Mus musculus OX=10090 GN=Cdc25a PE=2 SV=2
3	P48965	0.0	880	525	0.849	0.848	MPIP1_RAT M-phase inducer phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Cdc25a PE=1 SV=1
4	B5LY73	1.37e-148	439	562	0.492	0.459	B5LY73_DANRE M-phase inducer phosphatase OS=Danio rerio OX=7955 GN=cdc25A PE=2 SV=1
5	B8A5N7	2.09e-148	439	563	0.489	0.455	B8A5N7_DANRE M-phase inducer phosphatase OS=Danio rerio OX=7955 GN=cdc25 PE=3 SV=1
6	P30305	6.03e-132	397	580	0.450	0.407	MPIP2_HUMAN M-phase inducer phosphatase 2 OS=Homo sapiens OX=9606 GN=CDC25B PE=1 SV=2
7	P30306	6.92e-132	397	576	0.447	0.406	MPIP2_MOUSE M-phase inducer phosphatase 2 OS=Mus musculus OX=10090 GN=Cdc25b PE=1 SV=1
8	P48966	1.98e-124	377	574	0.431	0.394	MPIP2_RAT M-phase inducer phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Cdc25b PE=1 SV=1
9	P30309	8.92e-96	303	550	0.302	0.287	MPI1B_XENLA M-phase inducer phosphatase 1-B OS=Xenopus laevis OX=8355 GN=cdc25-1-b PE=1 SV=1
10	P30307	6.30e-79	257	473	0.258	0.285	MPIP3_HUMAN M-phase inducer phosphatase 3 OS=Homo sapiens OX=9606 GN=CDC25C PE=1 SV=2
11	D4ADT2	7.07e-71	235	455	0.206	0.237	D4ADT2_RAT M-phase inducer phosphatase OS=Rattus norvegicus OX=10116 GN=Cdc25c PE=3 SV=3
12	P48967	3.39e-69	230	447	0.202	0.237	MPIP3_MOUSE M-phase inducer phosphatase 3 OS=Mus musculus OX=10090 GN=Cdc25c PE=2 SV=2
13	P20483	6.08e-53	188	479	0.174	0.190	MPIP_DROME M-phase inducer phosphatase OS=Drosophila melanogaster OX=7227 GN=stg PE=1 SV=2
14	B5LY74	2.18e-48	174	387	0.170	0.230	B5LY74_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=si:ch211-202h22.3 PE=2 SV=1
15	Q03019	1.83e-39	150	426	0.151	0.185	TWINE_DROME Cdc25-like protein phosphatase twine OS=Drosophila melanogaster OX=7227 GN=twe PE=1 SV=2
16	P06652	7.19e-34	137	596	0.132	0.116	MPIP_SCHPO M-phase inducer phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc25 PE=1 SV=2
17	P30303	9.73e-31	127	556	0.145	0.137	MPIP_EMENI M-phase inducer phosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nimT PE=1 SV=2
18	O44552	5.16e-28	120	604	0.107	0.093	MPIP1_CAEEL M-phase inducer phosphatase cdc-25.1 OS=Caenorhabditis elegans OX=6239 GN=cdc-25.1 PE=3 SV=1
19	P23748	1.24e-24	109	554	0.115	0.108	MPIP_YEAST M-phase inducer phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIH1 PE=1 SV=2
20	P30634	8.15e-24	104	316	0.113	0.187	MPIP3_CAEEL M-phase inducer phosphatase cdc-25.3 OS=Caenorhabditis elegans OX=6239 GN=cdc-25.3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06617 M-inducer_phosp	1.6e-73	258.9	M-phase inducer phosphatase
2	PF00581 Rhodanese	9.2e-09	47.1	Rhodanese-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303706

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256442	0.999	G2/mitotic-specific cyclin-B1
2	9606.ENSP00000388648	0.999	Serine/threonine-protein kinase Chk1
3	9606.ENSP00000266970	0.998	Cyclin-dependent kinase 2
4	9606.ENSP00000372023	0.998	Serine/threonine-protein kinase Chk2
5	9606.ENSP00000378699	0.996	Cyclin-dependent kinase 1
6	9606.ENSP00000274026	0.995	Cyclin-A2
7	9606.ENSP00000359206	0.995	F-box/WD repeat-containing protein 1A
8	9606.ENSP00000262643	0.993	G1/S-specific cyclin-E1
9	9606.ENSP00000257904	0.984	Cyclin-dependent kinase 4
10	9606.ENSP00000265734	0.983	Cyclin-dependent kinase 6
11	9606.ENSP00000288207	0.983	G2/mitotic-specific cyclin-B2
12	9606.ENSP00000429089	0.982	G1/S-specific cyclin-E2
13	9606.ENSP00000342307	0.976	Forkhead box protein M1
14	9606.ENSP00000255465	0.973	Cyclin-A1
15	9606.ENSP00000227507	0.971	G1/S-specific cyclin-D1
16	9606.ENSP00000300093	0.970	Serine/threonine-protein kinase PLK1
17	9606.ENSP00000309163	0.969	CAAX prenyl protease 2
18	9606.ENSP00000479618	0.969	Myc proto-oncogene protein
19	9606.ENSP00000345571	0.967	Transcription factor E2F1
20	9606.ENSP00000402084	0.967	Wee1-like protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004721	1.000	phosphoprotein phosphatase activity
GO:0019900	0.986	kinase binding
GO:0019901	0.981	protein kinase binding
GO:0051087	0.918	chaperone binding
GO:0016740	0.318	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0000278	0.976	mitotic cell cycle
GO:0044770	0.941	cell cycle phase transition
GO:0044772	0.934	mitotic cell cycle phase transition
GO:0051726	0.918	regulation of cell cycle
GO:0048518	0.915	positive regulation of biological process
GO:0019222	0.884	regulation of metabolic process
GO:0048522	0.870	positive regulation of cellular process
GO:0060255	0.864	regulation of macromolecule metabolic process
GO:0050896	0.853	response to stimulus
GO:0080090	0.847	regulation of primary metabolic process
GO:0051171	0.846	regulation of nitrogen compound metabolic process
GO:0031323	0.796	regulation of cellular metabolic process
GO:0044843	0.753	cell cycle G1/S phase transition
GO:0000082	0.726	G1/S transition of mitotic cell cycle
GO:0051716	0.702	cellular response to stimulus
GO:0051246	0.682	regulation of protein metabolic process
GO:0065009	0.678	regulation of molecular function
GO:0031399	0.613	regulation of protein modification process
GO:0050790	0.606	regulation of catalytic activity
GO:0051338	0.600	regulation of transferase activity
GO:0008152	0.498	metabolic process
GO:0019220	0.476	regulation of phosphate metabolic process
GO:0044237	0.474	cellular metabolic process
GO:0042325	0.445	regulation of phosphorylation
GO:0001932	0.423	regulation of protein phosphorylation
GO:0071704	0.396	organic substance metabolic process
GO:0044238	0.391	primary metabolic process
GO:0006807	0.389	nitrogen compound metabolic process
GO:0043170	0.389	macromolecule metabolic process
GO:0045859	0.340	regulation of protein kinase activity
GO:0044839	0.315	cell cycle G2/M phase transition
GO:0019538	0.303	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.996	intracellular organelle lumen
GO:0005654	0.993	nucleoplasm
GO:0005829	0.990	cytosol
GO:0043228	0.685	non-membrane-bounded organelle
GO:0043232	0.684	intracellular non-membrane-bounded organelle
GO:0032991	0.509	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
EC:2.-.-.-	0.318	Transferases.

[back to server]