StarFunc result for job id P30305

User Input

>input (580 residues)
MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMH
DLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMD
PHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEA
GSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPD
RKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKT
LEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQ
QEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM
VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKR
VILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQ
DYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30305	1.000	1.000	1.498E-100	580	1.000	1.000	P30305.pdb.gz	MPIP2_HUMAN M-phase inducer phosphatase 2 OS=Homo sapiens OX=9606 GN=CDC25B PE=1 SV=2
2	AFDB:P30306	0.507	0.510	1.161E-80	576	0.809	0.814	P30306.pdb.gz	MPIP2_MOUSE M-phase inducer phosphatase 2 OS=Mus musculus OX=10090 GN=Cdc25b PE=1 SV=1
3	AFDB:B8A5N7	0.388	0.399	3.979E-50	563	0.462	0.476	B8A5N7.pdb.gz	B8A5N7_DANRE M-phase inducer phosphatase OS=Danio rerio OX=7955 GN=cdc25 PE=3 SV=1
4	PDB:3fs5A	0.171	0.559	3.163E-6	152	0.052	0.197	3fs5A.pdb.gz
5	PDB:3d1pA	0.160	0.661	4.715E-5	120	0.048	0.233	3d1pA.pdb.gz
6	PDB:1gmxA	0.145	0.630	1.761E-4	108	0.038	0.204	1gmxA.pdb.gz
7	PDB:1h4kX	0.133	0.261	4.447E-3	271	0.048	0.103	1h4kX.pdb.gz	A Persulfurated Cysteine Promotes Active Site Reactivity in Azotobacter Vinelandii Rhodanse
8	PDB:2jtqA	0.118	0.670	4.750E-3	85	0.031	0.212	2jtqA.pdb.gz
9	PDB:3hzuA	0.131	0.236	2.815E-2	292	0.031	0.062	3hzuA.pdb.gz
10	AFDB:Q9Y794	0.088	0.063	4.759E-2	972	0.126	0.075	Q9Y794.pdb.gz	ORC4_SCHPO Origin recognition complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc4 PE=1 SV=1
11	PDB:1t3kA	0.126	0.437	9.216E-2	132	0.038	0.167	1t3kA.pdb.gz	A small CDC25 dual-specificity tyrosine-phosphatase isoform in Arabidopsis thaliana.
12	PDB:5hutA	0.117	0.139	1.199E-1	469	0.033	0.041	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
13	PDB:3aayB	0.129	0.249	1.368E-1	277	0.038	0.079	3aayB.pdb.gz
14	PDB:6yxyEM	0.087	0.137	1.368E-1	330	0.045	0.079	6yxyEM.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
15	AFDB:Q8AXF4	0.056	0.053	3.920E-1	651	0.103	0.092	Q8AXF4.pdb.gz	FBX43_XENLA F-box only protein 43 OS=Xenopus laevis OX=8355 GN=fbxo43 PE=1 SV=1
16	AFDB:Q4QPP5	0.085	0.077	4.187E-1	673	0.126	0.108	Q4QPP5.pdb.gz	Q4QPP5_DROME Katanin p60 ATPase-containing subunit A1 OS=Drosophila melanogaster OX=7227 GN=kat-60L1 PE=2 SV=1
17	AFDB:E1JJR3	0.060	0.026	5.821E-1	1613	0.107	0.038	E1JJR3.pdb.gz	E1JJR3_DROME 5'-3' exoribonuclease 1 OS=Drosophila melanogaster OX=7227 GN=pcm PE=1 SV=1
18	AFDB:Q580M4	0.053	0.070	7.093E-1	408	0.126	0.179	Q580M4.pdb.gz	Q580M4_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.310 PE=4 SV=1
19	AFDB:Q93075	0.099	0.085	7.093E-1	761	0.162	0.124	Q93075.pdb.gz	TATD2_HUMAN Putative deoxyribonuclease TATDN2 OS=Homo sapiens OX=9606 GN=TATDN2 PE=1 SV=2
20	AFDB:A8DZ20	0.070	0.044	8.643E-1	973	0.119	0.071	A8DZ20.pdb.gz	A8DZ20_DROME Rho-type guanine nucleotide exchange factor, isoform D OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30305	0.0	1190	580	1.000	1.000	MPIP2_HUMAN M-phase inducer phosphatase 2 OS=Homo sapiens OX=9606 GN=CDC25B PE=1 SV=2
2	P30306	0.0	924	576	0.812	0.818	MPIP2_MOUSE M-phase inducer phosphatase 2 OS=Mus musculus OX=10090 GN=Cdc25b PE=1 SV=1
3	P48966	0.0	897	574	0.798	0.807	MPIP2_RAT M-phase inducer phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Cdc25b PE=1 SV=1
4	B8A5N7	3.02e-151	448	563	0.459	0.472	B8A5N7_DANRE M-phase inducer phosphatase OS=Danio rerio OX=7955 GN=cdc25 PE=3 SV=1
5	B5LY73	6.73e-151	447	562	0.460	0.475	B5LY73_DANRE M-phase inducer phosphatase OS=Danio rerio OX=7955 GN=cdc25A PE=2 SV=1
6	P30304	1.64e-135	406	524	0.417	0.462	MPIP1_HUMAN M-phase inducer phosphatase 1 OS=Homo sapiens OX=9606 GN=CDC25A PE=1 SV=2
7	P48964	4.47e-133	400	514	0.421	0.475	MPIP1_MOUSE M-phase inducer phosphatase 1 OS=Mus musculus OX=10090 GN=Cdc25a PE=2 SV=2
8	P48965	1.74e-123	375	525	0.395	0.436	MPIP1_RAT M-phase inducer phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Cdc25a PE=1 SV=1
9	P30309	4.03e-101	318	550	0.316	0.333	MPI1B_XENLA M-phase inducer phosphatase 1-B OS=Xenopus laevis OX=8355 GN=cdc25-1-b PE=1 SV=1
10	P30307	5.23e-83	269	473	0.224	0.275	MPIP3_HUMAN M-phase inducer phosphatase 3 OS=Homo sapiens OX=9606 GN=CDC25C PE=1 SV=2
11	D4ADT2	5.96e-72	239	455	0.181	0.231	D4ADT2_RAT M-phase inducer phosphatase OS=Rattus norvegicus OX=10116 GN=Cdc25c PE=3 SV=3
12	P48967	2.66e-70	235	447	0.172	0.224	MPIP3_MOUSE M-phase inducer phosphatase 3 OS=Mus musculus OX=10090 GN=Cdc25c PE=2 SV=2
13	P20483	7.65e-56	197	479	0.200	0.242	MPIP_DROME M-phase inducer phosphatase OS=Drosophila melanogaster OX=7227 GN=stg PE=1 SV=2
14	B5LY74	1.28e-48	175	387	0.141	0.212	B5LY74_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=si:ch211-202h22.3 PE=2 SV=1
15	Q03019	3.77e-42	159	426	0.193	0.263	TWINE_DROME Cdc25-like protein phosphatase twine OS=Drosophila melanogaster OX=7227 GN=twe PE=1 SV=2
16	P06652	6.75e-37	147	596	0.121	0.117	MPIP_SCHPO M-phase inducer phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc25 PE=1 SV=2
17	P30303	4.91e-31	129	556	0.116	0.121	MPIP_EMENI M-phase inducer phosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nimT PE=1 SV=2
18	O44552	3.80e-26	115	604	0.116	0.111	MPIP1_CAEEL M-phase inducer phosphatase cdc-25.1 OS=Caenorhabditis elegans OX=6239 GN=cdc-25.1 PE=3 SV=1
19	P23748	7.52e-24	107	554	0.114	0.119	MPIP_YEAST M-phase inducer phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIH1 PE=1 SV=2
20	P30634	8.16e-23	101	316	0.102	0.187	MPIP3_CAEEL M-phase inducer phosphatase cdc-25.3 OS=Caenorhabditis elegans OX=6239 GN=cdc-25.3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06617 M-inducer_phosp	4.6e-102	352.5	M-phase inducer phosphatase
2	PF00581 Rhodanese	6.6e-08	44.4	Rhodanese-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245960

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
2	9606.ENSP00000361930	0.999	14-3-3 protein beta/alpha
3	9606.ENSP00000378699	0.998	Cyclin-dependent kinase 1
4	9606.ENSP00000379287	0.995	14-3-3 protein zeta/delta
5	9606.ENSP00000248975	0.993	14-3-3 protein eta
6	9606.ENSP00000264335	0.993	14-3-3 protein epsilon
7	9606.ENSP00000388648	0.991	Serine/threonine-protein kinase Chk1
8	9606.ENSP00000256442	0.990	G2/mitotic-specific cyclin-B1
9	9606.ENSP00000371267	0.989	14-3-3 protein theta
10	9606.ENSP00000288207	0.985	G2/mitotic-specific cyclin-B2
11	9606.ENSP00000306330	0.984	14-3-3 protein gamma
12	9606.ENSP00000340989	0.980	14-3-3 protein sigma
13	9606.ENSP00000359206	0.979	F-box/WD repeat-containing protein 1A
14	9606.ENSP00000274026	0.978	Cyclin-A2
15	9606.ENSP00000229795	0.971	Mitogen-activated protein kinase 14
16	9606.ENSP00000216911	0.968	Aurora kinase A
17	9606.ENSP00000300093	0.967	Serine/threonine-protein kinase PLK1
18	9606.ENSP00000419782	0.958	Cyclin-dependent-like kinase 5
19	9606.ENSP00000356070	0.949	MAP kinase-activated protein kinase 2
20	9606.ENSP00000255465	0.945	Cyclin-A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0004725	0.998	protein tyrosine phosphatase activity
GO:0016740	0.317	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0000278	0.983	mitotic cell cycle
GO:0048518	0.941	positive regulation of biological process
GO:0048522	0.932	positive regulation of cellular process
GO:0051726	0.910	regulation of cell cycle
GO:0008152	0.901	metabolic process
GO:0022402	0.891	cell cycle process
GO:0071704	0.877	organic substance metabolic process
GO:0044237	0.877	cellular metabolic process
GO:0044238	0.874	primary metabolic process
GO:0044772	0.870	mitotic cell cycle phase transition
GO:0010564	0.866	regulation of cell cycle process
GO:0006807	0.848	nitrogen compound metabolic process
GO:0043170	0.848	macromolecule metabolic process
GO:0019222	0.786	regulation of metabolic process
GO:0036211	0.742	protein modification process
GO:0060255	0.733	regulation of macromolecule metabolic process
GO:0080090	0.714	regulation of primary metabolic process
GO:0051171	0.714	regulation of nitrogen compound metabolic process
GO:0007346	0.710	regulation of mitotic cell cycle
GO:0031323	0.701	regulation of cellular metabolic process
GO:0006796	0.690	phosphate-containing compound metabolic process
GO:0006468	0.472	protein phosphorylation
GO:0050896	0.348	response to stimulus
GO:0051246	0.335	regulation of protein metabolic process
GO:0045787	0.333	positive regulation of cell cycle
GO:0009893	0.317	positive regulation of metabolic process
GO:0065009	0.314	regulation of molecular function
GO:0010604	0.305	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.993	nucleoplasm
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005829	0.985	cytosol
GO:0015630	0.937	microtubule cytoskeleton
GO:0005819	0.677	spindle
GO:0005815	0.669	microtubule organizing center
GO:0005813	0.646	centrosome
GO:0000922	0.364	spindle pole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	0.998	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.998	protein-tyrosine-phosphatase.
EC:2.-.-.-	0.317	Transferases.

[back to server]