StarFunc result for job id P30307

User Input

>input (473 residues)
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK
CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP
NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK
VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ
DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK
PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30307	1.000	1.000	1.665E-77	473	1.000	1.000	P30307.pdb.gz	MPIP3_HUMAN M-phase inducer phosphatase 3 OS=Homo sapiens OX=9606 GN=CDC25C PE=1 SV=2
2	AFDB:D4ADT2	0.477	0.495	8.672E-52	455	0.622	0.646	D4ADT2.pdb.gz	D4ADT2_RAT M-phase inducer phosphatase OS=Rattus norvegicus OX=10116 GN=Cdc25c PE=3 SV=3
3	AFDB:P48967	0.462	0.488	2.370E-50	447	0.590	0.624	P48967.pdb.gz	MPIP3_MOUSE M-phase inducer phosphatase 3 OS=Mus musculus OX=10090 GN=Cdc25c PE=2 SV=2
4	PDB:3fs5A	0.209	0.582	1.529E-5	152	0.076	0.237	3fs5A.pdb.gz
5	PDB:1gmxA	0.173	0.628	3.022E-4	108	0.044	0.194	1gmxA.pdb.gz
6	PDB:3d1pA	0.186	0.657	7.491E-4	120	0.042	0.167	3d1pA.pdb.gz
7	PDB:6k6rA	0.179	0.592	1.070E-2	123	0.042	0.163	6k6rA.pdb.gz
8	PDB:3aayB	0.157	0.253	1.142E-2	277	0.063	0.108	3aayB.pdb.gz
9	PDB:2jtqA	0.136	0.645	1.579E-2	85	0.040	0.224	2jtqA.pdb.gz
10	PDB:1h4kX	0.153	0.252	1.798E-2	271	0.051	0.089	1h4kX.pdb.gz	A Persulfurated Cysteine Promotes Active Site Reactivity in Azotobacter Vinelandii Rhodanse
11	PDB:3hzuA	0.162	0.244	4.458E-2	292	0.042	0.068	3hzuA.pdb.gz
12	PDB:6yxxBb	0.157	0.440	5.778E-2	133	0.040	0.143	6yxxBb.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
13	PDB:5hvoA	0.114	0.116	6.165E-2	459	0.047	0.048	5hvoA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
14	AFDB:Q9I920	0.139	0.074	8.332E-1	1183	0.118	0.047	Q9I920.pdb.gz	BLM_CHICK RecQ-like DNA helicase BLM OS=Gallus gallus OX=9031 GN=BLM PE=1 SV=2
15	AFDB:O64728	0.108	0.057	1.400	1218	0.171	0.067	O64728.pdb.gz	STI_ARATH Protein STICHEL OS=Arabidopsis thaliana OX=3702 GN=STI PE=1 SV=2
16	AFDB:Q8L7V3	0.077	0.050	1.594	829	0.104	0.059	Q8L7V3.pdb.gz	PMTQ_ARATH Probable methyltransferase PMT26 OS=Arabidopsis thaliana OX=3702 GN=At5g64030 PE=2 SV=1
17	AFDB:P87323	0.128	0.118	2.204	522	0.118	0.107	P87323.pdb.gz	MCS4_SCHPO Response regulator mcs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcs4 PE=4 SV=1
18	AFDB:Q91689	0.071	0.067	3.471	503	0.093	0.087	Q91689.pdb.gz	ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis OX=8355 GN=zic2-a PE=2 SV=2
19	AFDB:Q91Y21	0.071	0.038	3.471	948	0.095	0.047	Q91Y21.pdb.gz	Q91Y21_MOUSE Protocadherin alpha 1 OS=Mus musculus OX=10090 GN=Pcdha1 PE=2 SV=1
20	AFDB:P22265	0.056	0.037	3.703	954	0.095	0.047	P22265.pdb.gz	TSH_DROME Protein teashirt OS=Drosophila melanogaster OX=7227 GN=tsh PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4ADT2	0.0	570	455	0.653	0.679	D4ADT2_RAT M-phase inducer phosphatase OS=Rattus norvegicus OX=10116 GN=Cdc25c PE=3 SV=3
2	D6RJC2	0.0	507	249	0.526	1.000	D6RJC2_HUMAN Cell division cycle 25C (Fragment) OS=Homo sapiens OX=9606 GN=CDC25C PE=1 SV=1
3	P30307	0.0	976	473	1.000	1.000	MPIP3_HUMAN M-phase inducer phosphatase 3 OS=Homo sapiens OX=9606 GN=CDC25C PE=1 SV=2
4	P48967	0.0	541	447	0.632	0.669	MPIP3_MOUSE M-phase inducer phosphatase 3 OS=Mus musculus OX=10090 GN=Cdc25c PE=2 SV=2
5	P30309	7.08e-138	409	550	0.514	0.442	MPI1B_XENLA M-phase inducer phosphatase 1-B OS=Xenopus laevis OX=8355 GN=cdc25-1-b PE=1 SV=1
6	D6RD20	3.06e-105	312	170	0.323	0.900	D6RD20_HUMAN Cell division cycle 25C (Fragment) OS=Homo sapiens OX=9606 GN=CDC25C PE=1 SV=1
7	P30305	1.90e-82	267	580	0.304	0.248	MPIP2_HUMAN M-phase inducer phosphatase 2 OS=Homo sapiens OX=9606 GN=CDC25B PE=1 SV=2
8	P30306	3.75e-82	266	576	0.273	0.224	MPIP2_MOUSE M-phase inducer phosphatase 2 OS=Mus musculus OX=10090 GN=Cdc25b PE=1 SV=1
9	B8A5N7	9.25e-81	263	563	0.266	0.224	B8A5N7_DANRE M-phase inducer phosphatase OS=Danio rerio OX=7955 GN=cdc25 PE=3 SV=1
10	B5LY73	1.06e-80	262	562	0.266	0.224	B5LY73_DANRE M-phase inducer phosphatase OS=Danio rerio OX=7955 GN=cdc25A PE=2 SV=1
11	P48966	2.35e-80	262	574	0.268	0.221	MPIP2_RAT M-phase inducer phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Cdc25b PE=1 SV=1
12	P30304	5.69e-79	257	524	0.285	0.258	MPIP1_HUMAN M-phase inducer phosphatase 1 OS=Homo sapiens OX=9606 GN=CDC25A PE=1 SV=2
13	P48964	1.74e-77	253	514	0.285	0.263	MPIP1_MOUSE M-phase inducer phosphatase 1 OS=Mus musculus OX=10090 GN=Cdc25a PE=2 SV=2
14	P48965	1.36e-75	248	525	0.249	0.225	MPIP1_RAT M-phase inducer phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Cdc25a PE=1 SV=1
15	P20483	3.76e-54	190	479	0.207	0.205	MPIP_DROME M-phase inducer phosphatase OS=Drosophila melanogaster OX=7227 GN=stg PE=1 SV=2
16	Q03019	6.15e-48	172	426	0.192	0.214	TWINE_DROME Cdc25-like protein phosphatase twine OS=Drosophila melanogaster OX=7227 GN=twe PE=1 SV=2
17	B5LY74	1.02e-45	165	387	0.167	0.204	B5LY74_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=si:ch211-202h22.3 PE=2 SV=1
18	P06652	8.04e-37	145	596	0.137	0.109	MPIP_SCHPO M-phase inducer phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc25 PE=1 SV=2
19	P30303	1.96e-29	123	556	0.148	0.126	MPIP_EMENI M-phase inducer phosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nimT PE=1 SV=2
20	P30634	2.37e-27	113	316	0.144	0.215	MPIP3_CAEEL M-phase inducer phosphatase cdc-25.3 OS=Caenorhabditis elegans OX=6239 GN=cdc-25.3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06617 M-inducer_phosp	1.7e-05	35.8	M-phase inducer phosphatase
2	PF00581 Rhodanese	1e-05	37.3	Rhodanese-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321656

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264335	0.999	14-3-3 protein epsilon
2	9606.ENSP00000300093	0.999	Serine/threonine-protein kinase PLK1
3	9606.ENSP00000372023	0.999	Serine/threonine-protein kinase Chk2
4	9606.ENSP00000378699	0.999	Cyclin-dependent kinase 1
5	9606.ENSP00000388648	0.999	Serine/threonine-protein kinase Chk1
6	9606.ENSP00000256442	0.998	G2/mitotic-specific cyclin-B1
7	9606.ENSP00000361930	0.998	14-3-3 protein beta/alpha
8	9606.ENSP00000379287	0.993	14-3-3 protein zeta/delta
9	9606.ENSP00000288207	0.992	G2/mitotic-specific cyclin-B2
10	9606.ENSP00000361275	0.990	Serine/threonine-protein kinase PLK3
11	9606.ENSP00000248975	0.986	14-3-3 protein eta
12	9606.ENSP00000266970	0.986	Cyclin-dependent kinase 2
13	9606.ENSP00000269305	0.986	Cellular tumor antigen p53
14	9606.ENSP00000274026	0.984	Cyclin-A2
15	9606.ENSP00000371267	0.978	14-3-3 protein theta
16	9606.ENSP00000340989	0.975	14-3-3 protein sigma
17	9606.ENSP00000306330	0.974	14-3-3 protein gamma
18	9606.ENSP00000303706	0.957	M-phase inducer phosphatase 1
19	9606.ENSP00000368686	0.946	Transcription factor E2F4
20	9606.ENSP00000229795	0.944	Mitogen-activated protein kinase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050699	1.000	WW domain binding
GO:0019901	1.000	protein kinase binding
GO:0004721	1.000	phosphoprotein phosphatase activity
GO:0016740	0.336	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0051726	0.991	regulation of cell cycle
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0031323	0.988	regulation of cellular metabolic process
GO:1903047	0.982	mitotic cell cycle process
GO:0051338	0.979	regulation of transferase activity
GO:0031399	0.978	regulation of protein modification process
GO:0010564	0.976	regulation of cell cycle process
GO:0051128	0.967	regulation of cellular component organization
GO:0042325	0.955	regulation of phosphorylation
GO:0044770	0.944	cell cycle phase transition
GO:0045859	0.944	regulation of protein kinase activity
GO:0033043	0.935	regulation of organelle organization
GO:0007346	0.929	regulation of mitotic cell cycle
GO:0044772	0.899	mitotic cell cycle phase transition
GO:0071900	0.846	regulation of protein serine/threonine kinase activity
GO:1904029	0.830	regulation of cyclin-dependent protein kinase activity
GO:0000079	0.822	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0044839	0.810	cell cycle G2/M phase transition
GO:0051783	0.791	regulation of nuclear division
GO:0000086	0.722	G2/M transition of mitotic cell cycle
GO:0008283	0.603	cell population proliferation
GO:0048522	0.525	positive regulation of cellular process
GO:0007088	0.417	regulation of mitotic nuclear division
GO:0008152	0.392	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.998	cytosol
GO:0043232	0.911	intracellular non-membrane-bounded organelle
GO:0016604	0.820	nuclear body
GO:0016607	0.758	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
EC:2.-.-.-	0.336	Transferases.

[back to server]