StarFunc result for job id P30414

User Input

>input (1462 residues)
MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYK
GSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNG
SQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATKS
IKDVFEKKRKKPTHSEGSDSSSNSSSSSESSSESELEHERSRRRKHKRRPKVKRSKKRRK
EASSSEEPRNKHAMNPKGHSERSDTNEKRSVDSSAKREKPVVRPEEIPPVPENRFLLRRD
MPVVTAEPEPKIPDVAPIVSDQKPSVSKSGRKIKGRGTIRYHTPPRSRSCSESDDDDSSE
TPPHWKEEMQRLRAYRPPSGEKWSKGDKLSDPCSSRWDERSLSQRSRSWSYNGYYSDLST
ARHSGHHKKRRKEKKVKHKKKGKKQKHCRRHKQTKKRRILIPSDIESSKSSTRRMKSSCD
RERSSRSSSLSSHHSSKRDWSKSDKDVQSSLTHSSRDSYRSKSHSQSYSRGSSRSRTASK
SSSHSRSRSKSRSSSKSGHRKRASKSPRKTASQLSENKPVKTEPLRATMAQNENVVVQPV
VAENIPVIPLSDSPPPSRWKPGQKPWKPSYERIQEMKAKTTHLLPIQSTYSLANIKETGS
SSSYHKREKNSESDQSTYSKYSDRSSESSPRSRSRSSRSRSYSRSYTRSRSLASSHSRSR
SPSSRSHSRNKYSDHSQCSRSSSYTSISSDDGRRAKRRLRSSGKKNSVSHKKHSSSSEKT
LHSKYVKGRDRSSCVRKYSESRSSLDYSSDSEQSSVQATQSAQEKEKQGQMERTHNKQEK
NRGEEKSKSERECPHSKKRTLKENLSDHLRNGSKPKRKNYAGSKWDSESNSERDVTKNSK
NDSHPSSDKEEGEATSDSESEVSEIHIKVKPTTKSSTNTSLPDDNGAWKSSKQRTSTSDS
EGSCSNSENNRGKPQKHKHGSKENLKREHTKKVKEKLKGKKDKKHKAPKRKQAFHWQPPL
EFGEEEEEEIDDKQVTQESKEKKVSENNETIKDNILKTEKSSEEDLSGKHDTVTVSSDLD
QFTKDDSKLSISPTALNTEENVACLQNIQHVEESVPNGVEDVLQTDDNMEICTPDRSSPA
KVEETSPLGNARLDTPDINIVLKQDMATEHPQAEVVKQESSMSESKVLGEVGKQDSSSAS
LASAGESTGKKEVAEKSQINLIDKKWKPLQGVGNLAAPNAATSSAVEVKVLTTVPEMKPQ
GLRIEIKSKNKVRPGSLFDEVRKTARLNRRPRNQESSSDEQTPSRDDDSQSRSPSRSRSK
SETKSRHRTRSVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSYRSYKSH
RTSSRSRSRSSSYDPHSRSRSYTYDSYYSRSRSRSRSQRSDSYHRGRSYNRRSRSCRSYG
SDSESDRSYSHHRSPSESSRYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30414	0.999	0.999	0.000	1462	1.000	1.000	P30414.pdb.gz	NKTR_HUMAN NK-tumor recognition protein OS=Homo sapiens OX=9606 GN=NKTR PE=1 SV=2
2	AFDB:Q13427	0.154	0.276	8.264E-42	754	0.196	0.381	Q13427.pdb.gz	PPIG_HUMAN Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens OX=9606 GN=PPIG PE=1 SV=2
3	AFDB:Q8IGV4	0.129	0.185	5.140E-34	1002	0.176	0.256	Q8IGV4.pdb.gz	Q8IGV4_DROME RE23622p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Moca-cyp PE=2 SV=1
4	PDB:5yzg3	0.117	0.992	2.609E-31	171	0.085	0.725	5yzg3.pdb.gz	Structure of a human catalytic step I spliceosome
5	AFDB:Q9LY75	0.121	0.307	2.172E-28	570	0.124	0.319	Q9LY75.pdb.gz	CYP63_ARATH Peptidyl-prolyl cis-trans isomerase CYP63 OS=Arabidopsis thaliana OX=3702 GN=CYP63 PE=1 SV=1
6	PDB:1ihgA	0.119	0.476	2.057E-27	364	0.068	0.275	1ihgA.pdb.gz
7	PDB:1mzwA	0.114	0.936	6.459E-26	173	0.058	0.491	1mzwA.pdb.gz
8	PDB:1e3bA	0.116	0.966	4.871E-25	172	0.061	0.517	1e3bA.pdb.gz	First Crystal Structure of a Medicinally Relevant Gold Protein Complex:Unexpected Binding of [Au(Pet (3))](+) to Histidine
9	PDB:3iciA	0.113	0.874	7.835E-25	187	0.062	0.481	3iciA.pdb.gz	Structural Basis of Cyclophilin B Binding by the Calnexin/Calreticulin P-domain.
10	PDB:1h0pA	0.112	0.886	6.271E-24	182	0.058	0.467	1h0pA.pdb.gz
11	PDB:5yzg1	0.111	0.658	1.623E-23	243	0.060	0.358	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
12	PDB:1vdnA	0.109	0.970	1.827E-23	161	0.061	0.553	1vdnA.pdb.gz	Crystal Structure Of Yeast Cyclophilin A Complexed With ACE-Ala-Ala-Pro-Ala-7-Amino-4-Methylcoumarin
13	PDB:4n1mA	0.110	0.941	1.462E-22	168	0.057	0.500	4n1mA.pdb.gz	Mapping the binding surface of Cyclophilin A.
14	PDB:7wffj	0.113	0.918	1.318E-21	173	0.061	0.514	7wffj.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
15	AFDB:P08640	0.041	0.042	3.063E-1	1367	0.138	0.148	P08640.pdb.gz	FLO11_YEAST Flocculation protein FLO11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FLO11 PE=1 SV=2
16	AFDB:D3YZU1	0.035	0.032	3.250E-1	2167	0.150	0.101	D3YZU1.pdb.gz	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
17	AFDB:Q9VHP9	0.035	0.034	3.250E-1	1411	0.134	0.139	Q9VHP9.pdb.gz	Q9VHP9_DROME Centromeric protein-C, isoform A OS=Drosophila melanogaster OX=7227 GN=Cenp-C PE=1 SV=4
18	AFDB:Q13029	0.055	0.050	5.548E-1	1718	0.149	0.127	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
19	AFDB:Q5RHP9	0.052	0.050	7.037E-1	1530	0.131	0.125	Q5RHP9.pdb.gz	ERIC3_HUMAN Glutamate-rich protein 3 OS=Homo sapiens OX=9606 GN=ERICH3 PE=1 SV=1
20	AFDB:Q61282	0.046	0.037	7.037E-1	2132	0.137	0.094	Q61282.pdb.gz	PGCA_MOUSE Aggrecan core protein OS=Mus musculus OX=10090 GN=Acan PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30414	0.0	2936	1462	1.000	1.000	NKTR_HUMAN NK-tumor recognition protein OS=Homo sapiens OX=9606 GN=NKTR PE=1 SV=2
2	O55035	1.64e-87	305	752	0.085	0.166	PPIG_RAT Peptidyl-prolyl cis-trans isomerase G OS=Rattus norvegicus OX=10116 GN=Ppig PE=1 SV=2
3	Q13427	1.85e-87	304	754	0.085	0.166	PPIG_HUMAN Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens OX=9606 GN=PPIG PE=1 SV=2
4	Q9VAW1	1.08e-75	275	970	0.080	0.121	Q9VAW1_DROME Moca-cyp, isoform A OS=Drosophila melanogaster OX=7227 GN=Moca-cyp PE=1 SV=1
5	Q8ISE5	1.35e-75	274	968	0.080	0.121	Q8ISE5_DROME Peptidylprolyl cis-trans isomerase OS=Drosophila melanogaster OX=7227 GN=Moca-cyp PE=2 SV=1
6	Q8IGV4	3.05e-75	274	1002	0.080	0.117	Q8IGV4_DROME RE23622p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Moca-cyp PE=2 SV=1
7	E9PG73	1.23e-73	264	739	0.077	0.153	E9PG73_HUMAN Peptidylprolyl isomerase G OS=Homo sapiens OX=9606 GN=PPIG PE=1 SV=1
8	Q9LY75	1.74e-62	226	570	0.068	0.175	CYP63_ARATH Peptidyl-prolyl cis-trans isomerase CYP63 OS=Arabidopsis thaliana OX=3702 GN=CYP63 PE=1 SV=1
9	C9JM79	1.21e-61	221	487	0.066	0.199	C9JM79_HUMAN Peptidyl-prolyl cis-trans isomerase G (Fragment) OS=Homo sapiens OX=9606 GN=PPIG PE=1 SV=1
10	Q9UA41	1.23e-61	210	174	0.067	0.563	PPID_DICDI Peptidyl-prolyl cis-trans isomerase D, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=cypD PE=1 SV=1
11	E5KN55	1.29e-56	203	370	0.071	0.281	E5KN55_HUMAN Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 PE=1 SV=1
12	Q08752	1.29e-56	203	370	0.071	0.281	PPID_HUMAN Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3
13	Q09637	1.43e-56	201	309	0.064	0.301	CYP9_CAEEL Peptidyl-prolyl cis-trans isomerase 9 OS=Caenorhabditis elegans OX=6239 GN=cyn-9 PE=2 SV=3
14	Q6DGG0	2.42e-56	202	370	0.071	0.281	PPID_RAT Peptidyl-prolyl cis-trans isomerase D OS=Rattus norvegicus OX=10116 GN=Ppid PE=1 SV=3
15	P14832	5.56e-56	193	162	0.059	0.531	CYPH_YEAST Peptidyl-prolyl cis-trans isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CPR1 PE=1 SV=3
16	Q9CR16	7.55e-56	201	370	0.071	0.281	PPID_MOUSE Peptidyl-prolyl cis-trans isomerase D OS=Mus musculus OX=10090 GN=Ppid PE=1 SV=3
17	P26882	2.20e-55	199	370	0.070	0.278	PPID_BOVIN Peptidyl-prolyl cis-trans isomerase D OS=Bos taurus OX=9913 GN=PPID PE=1 SV=6
18	E1BXG9	5.74e-55	198	370	0.069	0.273	E1BXG9_CHICK Peptidylprolyl isomerase D OS=Gallus gallus OX=9031 GN=PPID PE=1 SV=2
19	P18253	7.31e-55	190	162	0.063	0.568	CYPH_SCHPO Peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppi1 PE=3 SV=1
20	P24368	1.10e-54	192	216	0.063	0.426	PPIB_RAT Peptidyl-prolyl cis-trans isomerase B OS=Rattus norvegicus OX=10116 GN=Ppib PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00160 Pro_isomerase	6e-44	161.5	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000232978

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482075	0.865	Prostaglandin E synthase 3
2	9606.ENSP00000351646	0.852	Stress-induced-phosphoprotein 1
3	9606.ENSP00000358242	0.836	Arginine/serine-rich protein PNISR
4	9606.ENSP00000282516	0.835	Nipped-B-like protein
5	9606.ENSP00000362441	0.827	Transcriptional regulator ATRX
6	9606.ENSP00000348573	0.820	A-kinase anchor protein 9
7	9606.ENSP00000394734	0.791	Dual specificity protein kinase CLK1
8	9606.ENSP00000335153	0.787	Heat shock protein HSP 90-alpha
9	9606.ENSP00000360609	0.784	Heat shock protein HSP 90-beta
10	9606.ENSP00000377970	0.765	Activator of 90 kDa heat shock protein ATPase homolog 2
11	9606.ENSP00000216479	0.746	Activator of 90 kDa heat shock protein ATPase homolog 1
12	9606.ENSP00000292169	0.743	Protein S100-A1
13	9606.ENSP00000368017	0.727	Zinc finger C3H1 domain-containing protein
14	9606.ENSP00000439479	0.715	DmX-like protein 1
15	9606.ENSP00000362773	0.707	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
16	9606.ENSP00000359988	0.699	Serine/arginine-rich splicing factor 11
17	9606.ENSP00000367208	0.677	Protein SGT1 homolog
18	9606.ENSP00000373450	0.667	Sperm-associated antigen 1
19	9606.ENSP00000224073	0.662	Endothelial differentiation-related factor 1
20	9606.ENSP00000296215	0.662	Smad nuclear-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003755	1.000	peptidyl-prolyl cis-trans isomerase activity
GO:0016018	0.999	cyclosporin A binding
GO:0005515	0.949	protein binding
GO:1901363	0.434	heterocyclic compound binding
GO:0097159	0.434	organic cyclic compound binding
GO:0003676	0.422	nucleic acid binding
GO:0003723	0.394	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0018208	0.972	peptidyl-proline modification
GO:0009987	0.783	cellular process
GO:0065007	0.666	biological regulation
GO:0050789	0.624	regulation of biological process
GO:0050794	0.579	regulation of cellular process
GO:0000413	0.383	protein peptidyl-prolyl isomerization
GO:0019222	0.328	regulation of metabolic process
GO:0060255	0.304	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.996	intracellular organelle lumen
GO:0031981	0.990	nuclear lumen
GO:0005654	0.982	nucleoplasm
GO:0005737	0.968	cytoplasm
GO:0005829	0.847	cytosol
GO:0032991	0.555	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16237	1.000	[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0)
EC:5.2.1.8	1.000	peptidylprolyl isomerase.

[back to server]