StarFunc result for job id P30511

User Input

>input (346 residues)
MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSD
AAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN
GCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY
LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQ
PTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30511	1.000	1.000	2.413E-66	346	1.000	1.000	P30511.pdb.gz	HLAF_HUMAN HLA class I histocompatibility antigen, alpha chain F OS=Homo sapiens OX=9606 GN=HLA-F PE=1 SV=3
2	AFDB:P04439	0.893	0.849	2.389E-56	365	0.801	0.759	P04439.pdb.gz	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
3	AFDB:P10321	0.887	0.840	4.823E-56	366	0.780	0.738	P10321.pdb.gz	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
4	AFDB:P01893	0.897	0.859	5.986E-56	362	0.798	0.762	P01893.pdb.gz	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
5	AFDB:P01889	0.874	0.837	1.028E-55	362	0.795	0.760	P01889.pdb.gz	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
6	AFDB:P17693	0.901	0.922	3.373E-55	338	0.763	0.781	P17693.pdb.gz	HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G OS=Homo sapiens OX=9606 GN=HLA-G PE=1 SV=1
7	AFDB:A0A583ZBW8	0.917	0.869	9.105E-54	366	0.786	0.743	A0A583ZBW8.pdb.gz	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
8	AFDB:P01902	0.824	0.775	2.458E-52	368	0.668	0.628	P01902.pdb.gz	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
9	AFDB:Q95476	0.834	0.813	3.787E-52	355	0.699	0.682	Q95476.pdb.gz	Q95476_BOVIN MHC Class I (Fragment) OS=Bos taurus OX=9913 GN=JSP.1 PE=2 SV=1
10	AFDB:P01900	0.793	0.753	4.546E-51	365	0.665	0.630	P01900.pdb.gz	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
11	PDB:6d7gA	0.779	0.700	2.212E-43	386	0.607	0.544	6d7gA.pdb.gz
12	PDB:6e1iA	0.783	0.697	6.519E-43	389	0.584	0.519	6e1iA.pdb.gz
13	PDB:5j6hA	0.783	0.983	2.259E-42	275	0.564	0.709	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
14	PDB:6mp0A	0.767	0.686	1.371E-40	388	0.552	0.492	6mp0A.pdb.gz
15	PDB:3nwmA	0.774	0.698	4.501E-40	384	0.564	0.508	3nwmA.pdb.gz
16	PDB:2qriA	0.773	0.674	5.293E-40	398	0.543	0.472	2qriA.pdb.gz
17	PDB:3es6A	0.649	0.790	5.107E-26	277	0.289	0.361	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
18	PDB:6fgbA	0.635	0.806	1.725E-21	265	0.225	0.294	6fgbA.pdb.gz
19	PDB:3ov6A	0.600	0.557	3.628E-19	376	0.185	0.170	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
20	PDB:1cd1A	0.617	0.757	4.355E-18	273	0.188	0.238	1cd1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A583ZBW8	0.0	510	366	0.717	0.678	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
2	P01889	0.0	508	362	0.795	0.760	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
3	P01893	0.0	522	362	0.798	0.762	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
4	P04439	0.0	555	365	0.801	0.759	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
5	P17693	0.0	525	338	0.766	0.784	HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G OS=Homo sapiens OX=9606 GN=HLA-G PE=1 SV=1
6	P30511	0.0	715	346	1.000	1.000	HLAF_HUMAN HLA class I histocompatibility antigen, alpha chain F OS=Homo sapiens OX=9606 GN=HLA-F PE=1 SV=3
7	Q53YP1	0.0	518	366	0.723	0.683	Q53YP1_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
8	Q5RIP0	0.0	514	366	0.720	0.680	Q5RIP0_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
9	Q5SUL5	0.0	552	365	0.795	0.753	Q5SUL5_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1
10	Q7YQB1	1.54e-176	496	366	0.728	0.689	Q7YQB1_HUMAN MHC class I antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
11	P10321	5.41e-176	494	366	0.714	0.675	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
12	P13747	2.50e-163	462	358	0.668	0.645	HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E OS=Homo sapiens OX=9606 GN=HLA-E PE=1 SV=4
13	Q95476	2.60e-160	454	355	0.647	0.631	Q95476_BOVIN MHC Class I (Fragment) OS=Bos taurus OX=9913 GN=JSP.1 PE=2 SV=1
14	Q31093	1.97e-152	433	336	0.610	0.628	Q31093_MOUSE Histocompatibility 2, M region locus 3 OS=Mus musculus OX=10090 GN=H2-M3 PE=1 SV=1
15	Q8MHM0	1.11e-151	431	336	0.607	0.625	Q8MHM0_MOUSE Histocompatibility 2, M region locus 3 OS=Mus musculus OX=10090 GN=H2-M3 PE=2 SV=1
16	P01900	1.59e-151	432	365	0.665	0.630	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
17	P01902	1.88e-151	432	368	0.665	0.625	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
18	P01899	4.92e-151	431	362	0.659	0.630	HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=2
19	P01897	7.79e-151	430	362	0.662	0.633	HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain OS=Mus musculus OX=10090 GN=H2-L PE=1 SV=2
20	Q4KN81	2.61e-150	429	360	0.624	0.600	Q4KN81_MOUSE Histocompatibility 2, Q region locus 2 OS=Mus musculus OX=10090 GN=H2-Q2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	2.9e-12	58.1	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	9.3	17.7	CD80-like C2-set immunoglobulin domain
3	PF00047 ig	6.1	18.4	Immunoglobulin domain
4	PF13927 Ig_3	0.13	24.1	Immunoglobulin domain
5	PF00129 MHC_I	9.7e-86	297.4	Class I Histocompatibility antigen, domains alpha 1 and 2
6	PF16497 MHC_I_3	6.4	17.7	MHC-I family domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259951

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325525	0.998	Killer cell immunoglobulin-like receptor 3DL2
2	9606.ENSP00000315997	0.992	Leukocyte immunoglobulin-like receptor subfamily B member 1
3	9606.ENSP00000452780	0.988	Beta-2-microglobulin
4	9606.ENSP00000365817	0.976	HLA class I histocompatibility antigen, alpha chain E
5	9606.ENSP00000371333	0.970	Natural killer cells antigen CD94
6	9606.ENSP00000379873	0.969	HLA class I histocompatibility antigen, A-3 alpha chain
7	9606.ENSP00000363976	0.968	HLA class II histocompatibility antigen, DM alpha chain
8	9606.ENSP00000365402	0.968	HLA class I histocompatibility antigen, Cw-7 alpha chain
9	9606.ENSP00000375629	0.952	Leukocyte immunoglobulin-like receptor subfamily B member 2
10	9606.ENSP00000364016	0.948	Proteasome subunit beta type-8
11	9606.ENSP00000375608	0.939	Killer cell immunoglobulin-like receptor 3DL1
12	9606.ENSP00000393566	0.936	HLA class II histocompatibility antigen, DP alpha 1 chain
13	9606.ENSP00000245414	0.933	Interferon regulatory factor 1
14	9606.ENSP00000378786	0.930	HLA class II histocompatibility antigen, DR alpha chain
15	9606.ENSP00000353099	0.928	HLA class II histocompatibility antigen, DRB1-15 beta chain
16	9606.ENSP00000368699	0.928	Ubiquitin-like protein ISG15
17	9606.ENSP00000408146	0.928	HLA class II histocompatibility antigen, DP beta 1 chain
18	9606.ENSP00000398890	0.927	HLA class II histocompatibility antigen, DM beta chain
19	9606.ENSP00000229829	0.926	HLA class II histocompatibility antigen, DO alpha chain
20	9606.ENSP00000483430	0.926	Interferon alpha-inducible protein 27, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0033218	0.999	amide binding
GO:0003823	0.994	antigen binding
GO:0042277	0.993	peptide binding
GO:0042605	0.972	peptide antigen binding
GO:0044877	0.621	protein-containing complex binding
GO:0005102	0.561	signaling receptor binding
GO:0030881	0.382	beta-2-microglobulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0002697	0.991	regulation of immune effector process
GO:0031341	0.984	regulation of cell killing
GO:0048519	0.978	negative regulation of biological process
GO:0002703	0.977	regulation of leukocyte mediated immunity
GO:0050896	0.970	response to stimulus
GO:0002704	0.968	negative regulation of leukocyte mediated immunity
GO:0002715	0.966	regulation of natural killer cell mediated immunity
GO:0001914	0.966	regulation of T cell mediated cytotoxicity
GO:0050777	0.965	negative regulation of immune response
GO:0031348	0.964	negative regulation of defense response
GO:0042269	0.964	regulation of natural killer cell mediated cytotoxicity
GO:0002707	0.960	negative regulation of lymphocyte mediated immunity
GO:0002708	0.956	positive regulation of lymphocyte mediated immunity
GO:0032102	0.950	negative regulation of response to external stimulus
GO:0045824	0.937	negative regulation of innate immune response
GO:0001911	0.923	negative regulation of leukocyte mediated cytotoxicity
GO:0002376	0.915	immune system process
GO:0009987	0.909	cellular process
GO:0048522	0.887	positive regulation of cellular process
GO:0050778	0.878	positive regulation of immune response
GO:0019882	0.873	antigen processing and presentation
GO:0001817	0.818	regulation of cytokine production
GO:0001912	0.808	positive regulation of leukocyte mediated cytotoxicity
GO:0002711	0.797	positive regulation of T cell mediated immunity
GO:0032501	0.796	multicellular organismal process
GO:0006955	0.686	immune response
GO:0051240	0.641	positive regulation of multicellular organismal process
GO:0050865	0.520	regulation of cell activation
GO:0048002	0.506	antigen processing and presentation of peptide antigen
GO:0006950	0.464	response to stress
GO:0006952	0.447	defense response
GO:0009605	0.438	response to external stimulus
GO:0009607	0.419	response to biotic stimulus
GO:0051707	0.406	response to other organism
GO:0001916	0.360	positive regulation of T cell mediated cytotoxicity
GO:0051716	0.339	cellular response to stimulus
GO:0098542	0.302	defense response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098588	0.999	bounding membrane of organelle
GO:0030659	0.999	cytoplasmic vesicle membrane
GO:0005886	0.998	plasma membrane
GO:0005789	0.998	endoplasmic reticulum membrane
GO:0030139	0.996	endocytic vesicle
GO:0098553	0.994	lumenal side of endoplasmic reticulum membrane
GO:0030670	0.992	phagocytic vesicle membrane
GO:0009986	0.983	cell surface
GO:0098796	0.933	membrane protein complex
GO:0042611	0.914	MHC protein complex
GO:0030135	0.898	coated vesicle
GO:0030662	0.888	coated vesicle membrane
GO:0005768	0.884	endosome
GO:0010008	0.843	endosome membrane
GO:0030133	0.834	transport vesicle
GO:0012507	0.814	ER to Golgi transport vesicle membrane
GO:0005769	0.756	early endosome
GO:0055037	0.711	recycling endosome
GO:0055038	0.703	recycling endosome membrane
GO:0031901	0.629	early endosome membrane
GO:0005576	0.530	extracellular region
GO:0005794	0.469	Golgi apparatus
GO:0098852	0.348	lytic vacuole membrane
GO:0005764	0.342	lysosome
GO:0005765	0.333	lysosomal membrane
GO:0065010	0.319	extracellular membrane-bounded organelle
GO:0000139	0.317	Golgi membrane
GO:0009897	0.313	external side of plasma membrane
GO:1903561	0.308	extracellular vesicle
GO:0070062	0.304	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]