StarFunc result for job id P30520

User Input

>input (456 residues)
MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRC
QGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGL
EGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLR
MCDLVSDFDGFSERFKVLANQYKSIYPTLEIDIEGELQKLKGYMEKIKPMVRDGVYFLYE
ALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAY
TTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALAL
TKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKE
LPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4Z6H1	0.992	0.992	3.591E-93	456	0.991	0.991	A4Z6H1.pdb.gz	PURA2_PIG Adenylosuccinate synthetase isozyme 2 OS=Sus scrofa OX=9823 GN=ADSS2 PE=2 SV=1
2	PDB:2v40A	0.906	0.985	3.399E-78	419	0.919	1.000	2v40A.pdb.gz	Human Adenylosuccinate Synthetase Isozyme 2 in Complex with Gdp
3	AFDB:Q6NSN5	0.951	0.951	1.830E-76	456	0.724	0.724	Q6NSN5.pdb.gz	PURA1_DANRE Adenylosuccinate synthetase isozyme 1 OS=Danio rerio OX=7955 GN=adss1 PE=1 SV=1
4	AFDB:M0R629	0.943	0.941	1.807E-75	457	0.757	0.755	M0R629.pdb.gz	M0R629_RAT Adenylosuccinate synthetase isozyme 1 OS=Rattus norvegicus OX=10116 GN=Adss1 PE=1 SV=1
5	PDB:1j4bA	0.921	0.972	1.301E-70	432	0.743	0.785	1j4bA.pdb.gz
6	AFDB:Q6FMU9	0.919	0.969	2.749E-63	432	0.548	0.579	Q6FMU9.pdb.gz	PURA_CANGA Adenylosuccinate synthetase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K05027g PE=3 SV=1
7	AFDB:P80210	0.917	0.965	1.348E-61	433	0.537	0.566	P80210.pdb.gz	PURA_YEAST Adenylosuccinate synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE12 PE=1 SV=3
8	AFDB:Q02787	0.902	0.947	8.806E-60	434	0.507	0.532	Q02787.pdb.gz	PURA_SCHPO Adenylosuccinate synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade2 PE=1 SV=2
9	AFDB:P21900	0.903	0.964	4.843E-58	427	0.463	0.494	P21900.pdb.gz	PURA_DICDI Adenylosuccinate synthetase OS=Dictyostelium discoideum OX=44689 GN=purA PE=1 SV=1
10	AFDB:Q96529	0.899	0.838	6.656E-56	490	0.461	0.429	Q96529.pdb.gz	PURA_ARATH Adenylosuccinate synthetase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PURA PE=1 SV=1
11	PDB:1dj2A	0.901	0.957	8.603E-52	429	0.461	0.490	1dj2A.pdb.gz	Structures of adenylosuccinate synthetase from Triticum aestivum and Arabidopsis thaliana.
12	AFDB:Q3JZ68	0.885	0.937	4.430E-51	430	0.393	0.416	Q3JZ68.pdb.gz	PURA_STRA1 Adenylosuccinate synthetase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) OX=205921 GN=purA PE=3 SV=1
13	AFDB:P0A7D4	0.904	0.954	5.824E-50	432	0.401	0.424	P0A7D4.pdb.gz	PURA_ECOLI Adenylosuccinate synthetase OS=Escherichia coli (strain K12) OX=83333 GN=purA PE=1 SV=2
14	PDB:1cg0A	0.899	0.950	3.836E-47	431	0.395	0.418	1cg0A.pdb.gz	Mechanistic implications from crystalline complexes of wild-type and mutant adenylosuccinate synthetases from Escherichia coli.
15	PDB:6tnhA	0.621	0.807	8.826E-18	345	0.189	0.249	6tnhA.pdb.gz	A third purine biosynthetic pathway encoded by aminoadenine-based viral DNA genomes.
16	PDB:7odxA	0.577	0.739	2.083E-17	350	0.169	0.220	7odxA.pdb.gz	Characterization of a triad of genes in cyanophage S-2L sufficient to replace adenine by 2-aminoadenine in bacterial DNA.
17	PDB:6flfA	0.535	0.779	1.229E-16	305	0.167	0.249	6flfA.pdb.gz
18	PDB:2ffhA	0.175	0.194	1.721E-2	407	0.110	0.123	2ffhA.pdb.gz
19	PDB:2q9cA	0.245	0.352	5.727E-2	304	0.099	0.148	2q9cA.pdb.gz	X-ray Structures of the Signal Recognition Particle Receptor Reveal Targeting Cycle Intermediates.
20	PDB:5gadi	0.241	0.244	2.537E-1	450	0.094	0.096	5gadi.pdb.gz	Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A7H6	0.0	661	431	0.678	0.717	A0A8I6A7H6_RAT Adenylosuccinate synthetase OS=Rattus norvegicus OX=10116 GN=Adss1 PE=1 SV=1
2	A0A8I6AT75	0.0	832	452	0.897	0.905	A0A8I6AT75_RAT Adenylosuccinate synthetase isozyme 2 OS=Rattus norvegicus OX=10116 GN=Adss PE=1 SV=1
3	A0A8I6G9X7	0.0	621	460	0.673	0.667	A0A8I6G9X7_RAT Adenylosuccinate synthetase OS=Rattus norvegicus OX=10116 GN=Adss1 PE=1 SV=1
4	A4Z6H1	0.0	932	456	0.991	0.991	PURA2_PIG Adenylosuccinate synthetase isozyme 2 OS=Sus scrofa OX=9823 GN=ADSS2 PE=2 SV=1
5	D4AEP0	0.0	921	456	0.974	0.974	D4AEP0_RAT Adenylosuccinate synthetase isozyme 2 OS=Rattus norvegicus OX=10116 GN=Adss PE=1 SV=1
6	M0R629	0.0	729	457	0.761	0.759	M0R629_RAT Adenylosuccinate synthetase isozyme 1 OS=Rattus norvegicus OX=10116 GN=Adss1 PE=1 SV=1
7	P28650	0.0	727	457	0.757	0.755	PURA1_MOUSE Adenylosuccinate synthetase isozyme 1 OS=Mus musculus OX=10090 GN=Adss1 PE=1 SV=2
8	P30520	0.0	939	456	1.000	1.000	PURA2_HUMAN Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3
9	P46664	0.0	915	456	0.967	0.967	PURA2_MOUSE Adenylosuccinate synthetase isozyme 2 OS=Mus musculus OX=10090 GN=Adss2 PE=1 SV=2
10	Q6NSN5	0.0	701	456	0.724	0.724	PURA1_DANRE Adenylosuccinate synthetase isozyme 1 OS=Danio rerio OX=7955 GN=adss1 PE=1 SV=1
11	Q8N142	0.0	726	457	0.761	0.759	PURA1_HUMAN Adenylosuccinate synthetase isozyme 1 OS=Homo sapiens OX=9606 GN=ADSS1 PE=1 SV=1
12	Q6FMU9	1.07e-178	508	432	0.550	0.581	PURA_CANGA Adenylosuccinate synthetase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K05027g PE=3 SV=1
13	P80210	3.58e-176	502	433	0.537	0.566	PURA_YEAST Adenylosuccinate synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE12 PE=1 SV=3
14	Q02787	2.03e-164	472	434	0.511	0.537	PURA_SCHPO Adenylosuccinate synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade2 PE=1 SV=2
15	A0A8I6G7N1	3.51e-157	446	226	0.467	0.942	A0A8I6G7N1_RAT Adenylosuccinate synthetase OS=Rattus norvegicus OX=10116 GN=Adss PE=1 SV=1
16	A0A8I6GA01	4.25e-155	446	362	0.471	0.594	A0A8I6GA01_RAT Adenylosuccinate synthetase OS=Rattus norvegicus OX=10116 GN=Adss PE=1 SV=1
17	P21900	4.48e-152	441	427	0.465	0.496	PURA_DICDI Adenylosuccinate synthetase OS=Dictyostelium discoideum OX=44689 GN=purA PE=1 SV=1
18	Q96529	5.65e-142	417	490	0.467	0.435	PURA_ARATH Adenylosuccinate synthetase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PURA PE=1 SV=1
19	P65887	3.81e-111	336	428	0.395	0.421	PURA_STRPN Adenylosuccinate synthetase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=purA PE=1 SV=1
20	Q3JZ68	4.19e-111	336	430	0.395	0.419	PURA_STRA1 Adenylosuccinate synthetase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) OX=205921 GN=purA PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00709 Adenylsucc_synt	3.8e-186	630.5	Adenylosuccinate synthetase
2	PF09577 Spore_YpjB	95	14.2	Sporulation protein YpjB (SpoYpjB)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355493

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000485525	0.998	Adenylosuccinate lyase
2	9606.ENSP00000361471	0.990	Argininosuccinate synthase
3	9606.ENSP00000236959	0.988	Bifunctional purine biosynthesis protein PURH
4	9606.ENSP00000369456	0.974	Inosine triphosphate pyrophosphatase
5	9606.ENSP00000476535	0.970	annotation not available
6	9606.ENSP00000259727	0.969	GMP reductase 1
7	9606.ENSP00000345096	0.969	Inosine-5'-monophosphate dehydrogenase 1
8	9606.ENSP00000298556	0.968	Hypoxanthine-guanine phosphoribosyltransferase
9	9606.ENSP00000321584	0.967	Inosine-5'-monophosphate dehydrogenase 2
10	9606.ENSP00000264705	0.964	CAD protein
11	9606.ENSP00000430075	0.956	AMP deaminase 1
12	9606.ENSP00000379802	0.955	AMP deaminase 3
13	9606.ENSP00000256578	0.946	AMP deaminase 2
14	9606.ENSP00000245206	0.940	Aspartate aminotransferase, mitochondrial
15	9606.ENSP00000175506	0.932	Asparagine synthetase
16	9606.ENSP00000359539	0.928	Aspartate aminotransferase, cytoplasmic
17	9606.ENSP00000303077	0.926	Putative aspartate aminotransferase, cytoplasmic 2
18	9606.ENSP00000335246	0.921	Ectonucleoside triphosphate diphosphohydrolase 5
19	9606.ENSP00000301825	0.920	Ectonucleoside triphosphate diphosphohydrolase 3
20	9606.ENSP00000422375	0.920	U8 snoRNA-decapping enzyme

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004019	1.000	adenylosuccinate synthase activity
GO:0005515	0.998	protein binding
GO:0042802	0.507	identical protein binding
GO:1901363	0.393	heterocyclic compound binding
GO:0097159	0.393	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:1901135	0.991	carbohydrate derivative metabolic process
GO:0006163	0.991	purine nucleotide metabolic process
GO:0009123	0.988	nucleoside monophosphate metabolic process
GO:0044249	0.977	cellular biosynthetic process
GO:0009126	0.968	purine nucleoside monophosphate metabolic process
GO:0009161	0.967	ribonucleoside monophosphate metabolic process
GO:0072522	0.966	purine-containing compound biosynthetic process
GO:0009165	0.965	nucleotide biosynthetic process
GO:0006164	0.964	purine nucleotide biosynthetic process
GO:0009167	0.956	purine ribonucleoside monophosphate metabolic process
GO:0009150	0.956	purine ribonucleotide metabolic process
GO:0009156	0.956	ribonucleoside monophosphate biosynthetic process
GO:0009260	0.948	ribonucleotide biosynthetic process
GO:0009168	0.946	purine ribonucleoside monophosphate biosynthetic process
GO:0009152	0.942	purine ribonucleotide biosynthetic process
GO:0046033	0.716	AMP metabolic process
GO:0043436	0.448	oxoacid metabolic process
GO:0019752	0.416	carboxylic acid metabolic process
GO:0050896	0.356	response to stimulus
GO:0006520	0.311	amino acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005829	0.979	cytosol
GO:0043227	0.944	membrane-bounded organelle
GO:0043229	0.892	intracellular organelle
GO:0043231	0.880	intracellular membrane-bounded organelle
GO:0070062	0.442	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15753	1.000	GTP + IMP + L-aspartate = GDP + 2 H(+) + N(6)-(1,2-dicarboxyethyl)-AMP + phosphate
EC:6.3.4.4	1.000	adenylosuccinate synthase.

[back to server]