StarFunc result for job id P30530

User Input

>input (894 residues)
MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARGLTGTLRCQLQV
QGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVF
LGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPL
ATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTE
LEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLH
PHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPL
QGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLP
VPLEAWRPGQAQPVHQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETR
YGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGK
TLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRL
IGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQMLVKFMADIASGM
EYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIES
LADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYA
LMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGA
DPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PSX9	0.486	0.494	0.000	879	0.872	0.887	E9PSX9.pdb.gz	E9PSX9_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
2	AFDB:E9PSY0	0.401	0.404	0.000	888	0.879	0.885	E9PSY0.pdb.gz	E9PSY0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
3	AFDB:P30530	1.000	1.000	0.000	894	1.000	1.000	P30530.pdb.gz	UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Homo sapiens OX=9606 GN=AXL PE=1 SV=4
4	AFDB:Q00993	0.506	0.509	0.000	888	0.876	0.882	Q00993.pdb.gz	UFO_MOUSE Tyrosine-protein kinase receptor UFO OS=Mus musculus OX=10090 GN=Axl PE=1 SV=2
5	AFDB:Q12866	0.556	0.506	3.749E-93	999	0.427	0.382	Q12866.pdb.gz	MERTK_HUMAN Tyrosine-protein kinase Mer OS=Homo sapiens OX=9606 GN=MERTK PE=1 SV=2
6	AFDB:P57097	0.438	0.400	8.168E-92	994	0.426	0.383	P57097.pdb.gz	MERTK_RAT Tyrosine-protein kinase Mer OS=Rattus norvegicus OX=10116 GN=Mertk PE=2 SV=1
7	AFDB:Q06418	0.483	0.485	2.422E-90	890	0.422	0.424	Q06418.pdb.gz	TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens OX=9606 GN=TYRO3 PE=1 SV=1
8	AFDB:P55144	0.453	0.459	4.261E-90	880	0.411	0.417	P55144.pdb.gz	TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS=Mus musculus OX=10090 GN=Tyro3 PE=1 SV=2
9	AFDB:Q9YI66	0.422	0.430	1.285E-86	874	0.378	0.387	Q9YI66.pdb.gz	TYRO3_DANRE Tyrosine-protein kinase receptor TYRO3 OS=Danio rerio OX=7955 GN=tyro3 PE=2 SV=1
10	AFDB:Q02763	0.303	0.242	4.091E-52	1124	0.217	0.173	Q02763.pdb.gz	TIE2_HUMAN Angiopoietin-1 receptor OS=Homo sapiens OX=9606 GN=TEK PE=1 SV=2
11	PDB:1k9aB	0.275	0.548	5.240E-22	441	0.106	0.215	1k9aB.pdb.gz
12	PDB:2h8hA	0.269	0.520	1.192E-21	445	0.119	0.238	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.274	0.434	7.969E-21	555	0.109	0.175	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.270	0.432	8.906E-20	551	0.104	0.169	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.243	0.703	4.488E-16	283	0.078	0.247	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:2qkwB	0.258	0.724	1.074E-15	292	0.092	0.281	2qkwB.pdb.gz
17	PDB:6lk5A	0.255	0.796	3.325E-15	265	0.073	0.245	6lk5A.pdb.gz
18	PDB:2bujA	0.266	0.764	4.084E-15	291	0.076	0.234	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
19	PDB:5ufuA	0.269	0.621	4.084E-15	369	0.075	0.182	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
20	PDB:4rerA	0.264	0.497	6.158E-15	459	0.077	0.150	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K2H0	0.0	1591	879	0.872	0.887	A0A0G2K2H0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
2	E9PSX9	0.0	1531	858	0.850	0.886	E9PSX9_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
3	E9PSY0	0.0	1591	921	0.879	0.853	E9PSY0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
4	P30530	0.0	1839	894	1.000	1.000	UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Homo sapiens OX=9606 GN=AXL PE=1 SV=4
5	P55144	0.0	637	880	0.404	0.410	TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS=Mus musculus OX=10090 GN=Tyro3 PE=1 SV=2
6	P55146	0.0	645	880	0.409	0.416	TYRO3_RAT Tyrosine-protein kinase receptor TYRO3 OS=Rattus norvegicus OX=10116 GN=Tyro3 PE=1 SV=1
7	P57097	0.0	667	994	0.434	0.390	MERTK_RAT Tyrosine-protein kinase Mer OS=Rattus norvegicus OX=10116 GN=Mertk PE=2 SV=1
8	Q00993	0.0	1604	888	0.877	0.883	UFO_MOUSE Tyrosine-protein kinase receptor UFO OS=Mus musculus OX=10090 GN=Axl PE=1 SV=2
9	Q06418	0.0	653	890	0.421	0.422	TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens OX=9606 GN=TYRO3 PE=1 SV=1
10	Q12866	0.0	665	999	0.438	0.392	MERTK_HUMAN Tyrosine-protein kinase Mer OS=Homo sapiens OX=9606 GN=MERTK PE=1 SV=2
11	Q60805	0.0	671	994	0.433	0.389	MERTK_MOUSE Tyrosine-protein kinase Mer OS=Mus musculus OX=10090 GN=Mertk PE=1 SV=1
12	Q8VI99	0.0	1586	879	0.870	0.885	Q8VI99_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=3 SV=1
13	Q8VIA0	0.0	1608	888	0.877	0.883	Q8VIA0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=3 SV=1
14	Q9YI66	0.0	583	874	0.395	0.404	TYRO3_DANRE Tyrosine-protein kinase receptor TYRO3 OS=Danio rerio OX=7955 GN=tyro3 PE=2 SV=1
15	Q05688	1.78e-72	253	640	0.191	0.267	IGF1R_BOVIN Insulin-like growth factor 1 receptor (Fragment) OS=Bos taurus OX=9913 GN=IGF1R PE=2 SV=1
16	P08069	1.26e-68	251	1367	0.199	0.130	IGF1R_HUMAN Insulin-like growth factor 1 receptor OS=Homo sapiens OX=9606 GN=IGF1R PE=1 SV=1
17	G1K218	1.69e-68	251	1367	0.191	0.125	G1K218_BOVIN Tyrosine-protein kinase receptor OS=Bos taurus OX=9913 GN=IGF1R PE=3 SV=3
18	P24062	6.93e-67	246	1370	0.197	0.128	IGF1R_RAT Insulin-like growth factor 1 receptor OS=Rattus norvegicus OX=10116 GN=Igf1r PE=2 SV=2
19	Q60751	4.56e-66	243	1373	0.197	0.128	IGF1R_MOUSE Insulin-like growth factor 1 receptor OS=Mus musculus OX=10090 GN=Igf1r PE=1 SV=3
20	P16056	7.67e-66	243	1379	0.138	0.089	MET_MOUSE Hepatocyte growth factor receptor OS=Mus musculus OX=10090 GN=Met PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	2.3e+02	13.0	Phosphotransferase enzyme family
2	PF07654 C1-set	1.9e+02	13.8	Immunoglobulin C1-set domain
3	PF08205 C2-set_2	29	16.1	CD80-like C2-set immunoglobulin domain
4	PF11118 DUF2627	4.4e+02	12.9	Protein of unknown function (DUF2627)
5	PF14316 DUF4381	9e+02	11.5	Domain of unknown function (DUF4381)
6	PF00041 fn3	3.7e-15	67.4	Fibronectin type III domain
7	PF07679 I-set	8.6e-06	37.1	Immunoglobulin I-set domain
8	PF00047 ig	0.00066	31.1	Immunoglobulin domain
9	PF13895 Ig_2	1.4e-08	46.3	Immunoglobulin domain
10	PF13927 Ig_3	3.1e-11	55.0	Immunoglobulin domain
11	PF00069 Pkinase	6.4e-34	129.1	Protein kinase domain
12	PF17667 Pkinase_fungal	1.6e+02	12.4	Fungal protein kinase
13	PF07714 PK_Tyr_Ser-Thr	7.8e-87	302.4	Protein tyrosine and serine/threonine kinase
14	PF07686 V-set	0.0017	29.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301178

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331831	0.999	Growth arrest-specific protein 6
2	9606.ENSP00000319756	0.952	Tensin-2
3	9606.ENSP00000270139	0.944	Interferon alpha/beta receptor 1
4	9606.ENSP00000376345	0.937	Growth factor receptor-bound protein 2
5	9606.ENSP00000362680	0.922	Proto-oncogene tyrosine-protein kinase Src
6	9606.ENSP00000377783	0.920	Vitamin K-dependent protein S
7	9606.ENSP00000264033	0.915	E3 ubiquitin-protein ligase CBL
8	9606.ENSP00000401303	0.894	SHC-transforming protein 1
9	9606.ENSP00000428056	0.885	Phosphatidylinositol 3-kinase regulatory subunit alpha
10	9606.ENSP00000244007	0.877	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
11	9606.ENSP00000353590	0.857	Myosin-10
12	9606.ENSP00000364995	0.857	SHC-transforming protein 3
13	9606.ENSP00000482457	0.843	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
14	9606.ENSP00000371067	0.831	Tyrosine-protein kinase JAK2
15	9606.ENSP00000262995	0.830	GRB2-associated-binding protein 1
16	9606.ENSP00000264554	0.829	SHC-transforming protein 2
17	9606.ENSP00000329668	0.829	SHC-transforming protein 4
18	9606.ENSP00000343204	0.826	Tyrosine-protein kinase JAK1
19	9606.ENSP00000275493	0.825	Epidermal growth factor receptor
20	9606.ENSP00000290246	0.820	Engulfment and cell motility protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043548	1.000	phosphatidylinositol 3-kinase binding
GO:0032036	1.000	myosin heavy chain binding
GO:0019838	0.997	growth factor binding
GO:0004672	0.996	protein kinase activity
GO:0004713	0.983	protein tyrosine kinase activity
GO:0038023	0.880	signaling receptor activity
GO:0004888	0.832	transmembrane signaling receptor activity
GO:0004714	0.823	transmembrane receptor protein tyrosine kinase activity
GO:0140272	0.427	exogenous protein binding
GO:0001618	0.374	virus receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0051716	0.984	cellular response to stimulus
GO:0048523	0.981	negative regulation of cellular process
GO:0006950	0.978	response to stress
GO:0032501	0.965	multicellular organismal process
GO:0009611	0.965	response to wounding
GO:0042221	0.958	response to chemical
GO:0070887	0.946	cellular response to chemical stimulus
GO:0032502	0.945	developmental process
GO:0043069	0.945	negative regulation of programmed cell death
GO:0043066	0.939	negative regulation of apoptotic process
GO:0048856	0.935	anatomical structure development
GO:1901701	0.916	cellular response to oxygen-containing compound
GO:0010033	0.910	response to organic substance
GO:0048771	0.906	tissue remodeling
GO:0030154	0.872	cell differentiation
GO:0048518	0.857	positive regulation of biological process
GO:0000302	0.791	response to reactive oxygen species
GO:0019222	0.789	regulation of metabolic process
GO:0048522	0.784	positive regulation of cellular process
GO:0023052	0.779	signaling
GO:0007154	0.779	cell communication
GO:0048513	0.778	animal organ development
GO:0060255	0.774	regulation of macromolecule metabolic process
GO:0007165	0.773	signal transduction
GO:0034614	0.773	cellular response to reactive oxygen species
GO:0048678	0.695	response to axon injury
GO:0070301	0.691	cellular response to hydrogen peroxide
GO:0048583	0.653	regulation of response to stimulus
GO:0042246	0.649	tissue regeneration
GO:0031100	0.637	animal organ regeneration
GO:0008152	0.555	metabolic process
GO:0051239	0.532	regulation of multicellular organismal process
GO:0071704	0.523	organic substance metabolic process
GO:0044238	0.495	primary metabolic process
GO:0006807	0.490	nitrogen compound metabolic process
GO:0043170	0.485	macromolecule metabolic process
GO:0044237	0.460	cellular metabolic process
GO:0023051	0.430	regulation of signaling
GO:1901564	0.430	organonitrogen compound metabolic process
GO:0010646	0.420	regulation of cell communication
GO:0009966	0.408	regulation of signal transduction
GO:0007166	0.405	cell surface receptor signaling pathway
GO:0071310	0.381	cellular response to organic substance
GO:0009892	0.372	negative regulation of metabolic process
GO:0010468	0.368	regulation of gene expression
GO:0031323	0.366	regulation of cellular metabolic process
GO:0002682	0.341	regulation of immune system process
GO:0009893	0.329	positive regulation of metabolic process
GO:0080090	0.327	regulation of primary metabolic process
GO:0010605	0.322	negative regulation of macromolecule metabolic process
GO:0007275	0.320	multicellular organism development
GO:0051171	0.313	regulation of nitrogen compound metabolic process
GO:0051240	0.309	positive regulation of multicellular organismal process
GO:0019538	0.301	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.999	membrane-bounded organelle
GO:0005622	0.998	intracellular anatomical structure
GO:0005737	0.984	cytoplasm
GO:0043231	0.966	intracellular membrane-bounded organelle
GO:0031982	0.909	vesicle
GO:0005576	0.903	extracellular region
GO:0012505	0.825	endomembrane system
GO:0005615	0.738	extracellular space
GO:0043230	0.677	extracellular organelle
GO:0065010	0.667	extracellular membrane-bounded organelle
GO:1903561	0.635	extracellular vesicle
GO:0005829	0.628	cytosol
GO:0031410	0.574	cytoplasmic vesicle
GO:0070062	0.562	extracellular exosome
GO:0009986	0.550	cell surface
GO:0031090	0.392	organelle membrane
GO:0005634	0.370	nucleus
GO:0098588	0.327	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.996	Phosphotransferases with an alcohol group as acceptor.
RHEA:10596	0.983	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.1	0.823	receptor protein-tyrosine kinase.

[back to server]