StarFunc result for job id P30532

User Input

>input (468 residues)
MAARGSGPRALRLLLLVQLVAGRCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYER
WVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKV
IRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD
LQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYV
TYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIE
EIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTL
PKLLCMRSHVDRYFTQKEETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDW
KFIAQVLDRMFLWTFLFVSIVGSLGLFVPVIYKWANILIPVHIGNANK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30532	1.000	1.000	1.189E-84	468	1.000	1.000	P30532.pdb.gz	ACHA5_HUMAN Neuronal acetylcholine receptor subunit alpha-5 OS=Homo sapiens OX=9606 GN=CHRNA5 PE=1 SV=2
2	AFDB:Q2MKA5	0.926	0.928	5.202E-75	467	0.853	0.854	Q2MKA5.pdb.gz	ACHA5_MOUSE Neuronal acetylcholine receptor subunit alpha-5 OS=Mus musculus OX=10090 GN=Chrna5 PE=2 SV=1
3	AFDB:P26152	0.945	0.974	1.975E-74	454	0.810	0.835	P26152.pdb.gz	ACHA5_CHICK Neuronal acetylcholine receptor subunit alpha-5 OS=Gallus gallus OX=9031 GN=CHRNA5 PE=1 SV=2
4	AFDB:Q05901	0.862	0.880	2.902E-62	458	0.643	0.657	Q05901.pdb.gz	ACHB3_HUMAN Neuronal acetylcholine receptor subunit beta-3 OS=Homo sapiens OX=9606 GN=CHRNB3 PE=1 SV=2
5	AFDB:P12391	0.861	0.869	6.126E-62	464	0.618	0.623	P12391.pdb.gz	ACHB3_RAT Neuronal acetylcholine receptor subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Chrnb3 PE=2 SV=1
6	AFDB:Q15822	0.839	0.743	1.034E-53	529	0.511	0.452	Q15822.pdb.gz	ACHA2_HUMAN Neuronal acetylcholine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=CHRNA2 PE=1 SV=2
7	AFDB:Q15825	0.849	0.804	5.126E-53	494	0.457	0.433	Q15825.pdb.gz	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
8	AFDB:B3DGY1	0.829	0.747	5.085E-52	520	0.500	0.450	B3DGY1.pdb.gz
9	AFDB:Q91X60	0.815	0.746	5.658E-52	512	0.498	0.455	Q91X60.pdb.gz	ACHA2_MOUSE Neuronal acetylcholine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Chrna2 PE=2 SV=1
10	AFDB:P43681	0.832	0.623	5.968E-52	627	0.530	0.396	P43681.pdb.gz	ACHA4_HUMAN Neuronal acetylcholine receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=CHRNA4 PE=1 SV=2
11	PDB:6i53B	0.562	0.764	2.051E-22	338	0.124	0.172	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:4aq5E	0.607	0.744	3.689E-22	370	0.269	0.341	4aq5E.pdb.gz
13	PDB:6i53A	0.560	0.739	3.659E-21	349	0.124	0.166	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
14	PDB:4hfcA	0.530	0.776	1.056E-19	311	0.105	0.158	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
15	PDB:7kuyE	0.532	0.714	2.886E-18	338	0.130	0.180	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
16	PDB:2w8gC	0.407	0.855	2.079E-17	217	0.105	0.226	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
17	PDB:4afhA	0.398	0.842	5.731E-17	213	0.126	0.277	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
18	PDB:7l6qA	0.483	0.705	1.555E-14	311	0.111	0.167	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
19	PDB:6zgdA	0.450	0.703	1.428E-10	288	0.109	0.177	6zgdA.pdb.gz
20	PDB:5nzuD	0.087	0.092	8.354E-4	427	0.068	0.075	5nzuD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P12391	0.0	597	464	0.605	0.610	ACHB3_RAT Neuronal acetylcholine receptor subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Chrnb3 PE=2 SV=1
2	P20420	0.0	840	452	0.865	0.896	ACHA5_RAT Neuronal acetylcholine receptor subunit alpha-5 OS=Rattus norvegicus OX=10116 GN=Chrna5 PE=1 SV=1
3	P26152	0.0	800	454	0.810	0.835	ACHA5_CHICK Neuronal acetylcholine receptor subunit alpha-5 OS=Gallus gallus OX=9031 GN=CHRNA5 PE=1 SV=2
4	P30532	0.0	964	468	1.000	1.000	ACHA5_HUMAN Neuronal acetylcholine receptor subunit alpha-5 OS=Homo sapiens OX=9606 GN=CHRNA5 PE=1 SV=2
5	Q05901	0.0	619	458	0.637	0.651	ACHB3_HUMAN Neuronal acetylcholine receptor subunit beta-3 OS=Homo sapiens OX=9606 GN=CHRNB3 PE=1 SV=2
6	Q2MKA5	0.0	813	467	0.857	0.859	ACHA5_MOUSE Neuronal acetylcholine receptor subunit alpha-5 OS=Mus musculus OX=10090 GN=Chrna5 PE=2 SV=1
7	Q8BMN3	0.0	593	464	0.611	0.616	ACHB3_MOUSE Neuronal acetylcholine receptor subunit beta-3 OS=Mus musculus OX=10090 GN=Chrnb3 PE=2 SV=1
8	Q9R0W9	2.37e-148	434	494	0.466	0.441	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
9	Q15822	1.13e-147	433	529	0.504	0.446	ACHA2_HUMAN Neuronal acetylcholine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=CHRNA2 PE=1 SV=2
10	P43143	1.64e-147	432	493	0.468	0.444	ACHA6_RAT Neuronal acetylcholine receptor subunit alpha-6 OS=Rattus norvegicus OX=10116 GN=Chrna6 PE=2 SV=1
11	A0A0X1KG79	2.86e-146	429	507	0.504	0.465	A0A0X1KG79_HUMAN Cholinergic receptor nicotinic alpha 2 subunit OS=Homo sapiens OX=9606 GN=CHRNA2 PE=3 SV=1
12	Q15825	5.33e-145	425	494	0.453	0.429	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
13	P32297	3.57e-142	419	505	0.459	0.426	ACHA3_HUMAN Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4
14	P09481	2.12e-136	404	496	0.479	0.452	ACHA3_CHICK Neuronal acetylcholine receptor subunit alpha-3 OS=Gallus gallus OX=9031 GN=CHRNA3 PE=1 SV=2
15	Q91X60	6.42e-133	395	512	0.444	0.406	ACHA2_MOUSE Neuronal acetylcholine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Chrna2 PE=2 SV=1
16	O70174	7.04e-133	399	629	0.427	0.318	ACHA4_MOUSE Neuronal acetylcholine receptor subunit alpha-4 OS=Mus musculus OX=10090 GN=Chrna4 PE=1 SV=2
17	P43681	1.19e-132	398	627	0.429	0.321	ACHA4_HUMAN Neuronal acetylcholine receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=CHRNA4 PE=1 SV=2
18	P12389	1.63e-132	394	511	0.432	0.395	ACHA2_RAT Neuronal acetylcholine receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Chrna2 PE=2 SV=2
19	Q0PJT8	4.08e-132	397	627	0.423	0.316	Q0PJT8_DANRE Cholinergic receptor, nicotinic, alpha 4b OS=Danio rerio OX=7955 GN=LOC556619 PE=2 SV=1
20	P04757	5.38e-132	392	499	0.440	0.413	ACHA3_RAT Neuronal acetylcholine receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Chrna3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17892 Cadherin_5	7e+02	11.5	Cadherin-like domain
2	PF02931 Neur_chan_LBD	1.7e-68	241.8	Neurotransmitter-gated ion-channel ligand binding domain
3	PF02932 Neur_chan_memb	4.9e-58	208.6	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299565

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357461	0.890	Neuronal acetylcholine receptor subunit beta-2
2	9606.ENSP00000315602	0.885	Neuronal acetylcholine receptor subunit alpha-3
3	9606.ENSP00000261751	0.882	Neuronal acetylcholine receptor subunit beta-4
4	9606.ENSP00000044462	0.823	Proteasome subunit alpha type-4
5	9606.ENSP00000455459	0.738	Hydroxylysine kinase
6	9606.ENSP00000301141	0.730	Cytochrome P450 2A6
7	9606.ENSP00000407546	0.695	Neuronal acetylcholine receptor subunit alpha-7
8	9606.ENSP00000258886	0.686	Iron-responsive element-binding protein 2
9	9606.ENSP00000359285	0.660	Neuronal acetylcholine receptor subunit alpha-4
10	9606.ENSP00000264344	0.659	Protein FAM13A
11	9606.ENSP00000246515	0.654	Secreted Ly-6/uPAR-related protein 1
12	9606.ENSP00000276410	0.653	Neuronal acetylcholine receptor subunit alpha-6
13	9606.ENSP00000385026	0.651	Neuronal acetylcholine receptor subunit alpha-2
14	9606.ENSP00000299847	0.642	CHRNA7-FAM7A fusion protein
15	9606.ENSP00000306678	0.638	Ankyrin repeat and kinase domain containing 1
16	9606.ENSP00000261007	0.624	Acetylcholine receptor subunit alpha
17	9606.ENSP00000296575	0.610	Hedgehog-interacting protein
18	9606.ENSP00000313854	0.610	Cleft lip and palate transmembrane protein 1-like protein
19	9606.ENSP00000354859	0.601	D(2) dopamine receptor
20	9606.ENSP00000374145	0.591	Acetylcholine receptor subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022848	1.000	acetylcholine-gated monoatomic cation-selective channel activity
GO:0005515	0.996	protein binding
GO:0004888	0.992	transmembrane signaling receptor activity
GO:0015464	0.954	acetylcholine receptor activity
GO:0042165	0.885	neurotransmitter binding
GO:0050997	0.862	quaternary ammonium group binding
GO:0043167	0.843	ion binding
GO:0042166	0.833	acetylcholine binding
GO:0015318	0.470	inorganic molecular entity transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0042391	0.991	regulation of membrane potential
GO:0035094	0.981	response to nicotine
GO:0050794	0.975	regulation of cellular process
GO:0051899	0.948	membrane depolarization
GO:0007154	0.928	cell communication
GO:0023052	0.927	signaling
GO:0099536	0.883	synaptic signaling
GO:0032501	0.867	multicellular organismal process
GO:0051716	0.511	cellular response to stimulus
GO:0007165	0.401	signal transduction
GO:0099537	0.375	trans-synaptic signaling
GO:0007268	0.364	chemical synaptic transmission
GO:0030534	0.325	adult behavior

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005892	0.996	acetylcholine-gated channel complex
GO:0043226	0.640	organelle
GO:0030054	0.375	cell junction
GO:0098590	0.315	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]