StarFunc result for job id P30533

User Input

>input (357 residues)
MAPRRVRSFLRGLPALLLLLLFLGPWPAASHGGKYSREKNQPKPSPKRESGEEFRMEKLN
QLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILA
KYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHK
EKVHEYNVLLETLSRTEEIHENVISPSDLSDIKGSVLHSRHTELKEKLRSINQGLDRLRR
VSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLEI
AHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30533	1.000	1.000	8.504E-48	357	1.000	1.000	P30533.pdb.gz	AMRP_HUMAN Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1
2	AFDB:P55302	0.845	0.838	1.023E-36	360	0.759	0.753	P55302.pdb.gz	AMRP_MOUSE Alpha-2-macroglobulin receptor-associated protein OS=Mus musculus OX=10090 GN=Lrpap1 PE=1 SV=1
3	PDB:2p01A	0.262	0.288	3.102E-31	323	0.905	1.000	2p01A.pdb.gz
4	AFDB:Q9VH64	0.426	0.405	5.319E-14	379	0.305	0.288	Q9VH64.pdb.gz	Q9VH64_DROME LD29322p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8507 PE=1 SV=1
5	AFDB:Q6GKU7	0.175	0.123	4.033E-2	515	0.162	0.113	Q6GKU7.pdb.gz	Q6GKU7_ARATH At1g64880 OS=Arabidopsis thaliana OX=3702 GN=At1g64880 PE=1 SV=1
6	AFDB:B3DH36	0.170	0.157	1.870E-1	403	0.140	0.124	B3DH36.pdb.gz
7	AFDB:Q9VWZ1	0.127	0.085	2.814E-1	556	0.129	0.083	Q9VWZ1.pdb.gz	Q9VWZ1_DROME Diskette OS=Drosophila melanogaster OX=7227 GN=Ada3 PE=1 SV=1
8	AFDB:Q6ZN84	0.134	0.084	4.026E-1	652	0.185	0.101	Q6ZN84.pdb.gz	CCD81_HUMAN Coiled-coil domain-containing protein 81 OS=Homo sapiens OX=9606 GN=CCDC81 PE=1 SV=2
9	AFDB:A0A1B0GUN0	0.166	0.116	5.471E-1	527	0.132	0.089	A0A1B0GUN0.pdb.gz	A0A1B0GUN0_HUMAN Pleckstrin homology domain containing A7 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
10	AFDB:Q86SQ0	0.130	0.049	5.758E-1	1253	0.143	0.041	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
11	AFDB:Q8N715	0.113	0.066	6.060E-1	623	0.218	0.125	Q8N715.pdb.gz	CC185_HUMAN Coiled-coil domain-containing protein 185 OS=Homo sapiens OX=9606 GN=CCDC185 PE=1 SV=2
12	PDB:4k7rA	0.172	0.144	6.333E-1	429	0.087	0.072	4k7rA.pdb.gz	Crystal Structures of CusC Review Conformational Changes Accompanying Folding and Transmembrane Channel Formation.
13	PDB:6rcuA	0.200	0.228	8.177E-1	304	0.084	0.099	6rcuA.pdb.gz
14	PDB:6t9iK	0.125	0.147	8.177E-1	279	0.112	0.143	6t9iK.pdb.gz
15	PDB:1ek9A	0.126	0.107	8.606E-1	428	0.120	0.100	1ek9A.pdb.gz
16	PDB:4k34B	0.142	0.144	1.296	351	0.092	0.094	4k34B.pdb.gz
17	PDB:4iggB	0.152	0.082	1.590	771	0.140	0.065	4iggB.pdb.gz
18	PDB:4k34A	0.149	0.140	1.590	381	0.095	0.089	4k34A.pdb.gz
19	PDB:1qvrA	0.134	0.062	1.950	803	0.070	0.031	1qvrA.pdb.gz	The Structure of ClpB: A Molecular Chaperone that Rescues Proteins from an Aggregated State
20	PDB:4xwjA	0.170	0.368	1.950	153	0.048	0.111	4xwjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30533	0.0	711	357	1.000	1.000	AMRP_HUMAN Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1
2	P55302	0.0	522	360	0.714	0.708	AMRP_MOUSE Alpha-2-macroglobulin receptor-associated protein OS=Mus musculus OX=10090 GN=Lrpap1 PE=1 SV=1
3	Q99068	0.0	519	360	0.711	0.706	AMRP_RAT Alpha-2-macroglobulin receptor-associated protein OS=Rattus norvegicus OX=10116 GN=Lrpap1 PE=1 SV=2
4	Q9VH64	8.56e-34	130	379	0.350	0.330	Q9VH64_DROME LD29322p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8507 PE=1 SV=1
5	Q12036	0.057	36.6	173	0.053	0.110	PPT2_YEAST Mitochondrial holo-[acyl-carrier-protein] synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PPT2 PE=1 SV=2
6	G7L166	1.4	33.5	674	0.140	0.074	RAM1_MEDTR GRAS family protein RAM1 OS=Medicago truncatula OX=3880 GN=RAM1 PE=1 SV=1
7	A0A8I6B1X1	8.8	30.8	949	0.104	0.039	A0A8I6B1X1_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
8	A0A5P8DHN0	9.8	30.8	8815	0.104	0.004	A0A5P8DHN0_RAT Nesprin 1 long isoform OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
9	A0A8I6ABC0	9.8	30.8	8788	0.104	0.004	A0A8I6ABC0_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
10	A0A5P8DHK4	10.0	30.8	8697	0.104	0.004	A0A5P8DHK4_RAT Nesprin 1 short isoform OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
11	A0A8I5ZJB9	10.0	30.8	8815	0.104	0.004	A0A8I5ZJB9_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06401 Alpha-2-MRAP_C	1.2e-68	242.8	Alpha-2-macroglobulin RAP, C-terminal domain
2	PF06400 Alpha-2-MRAP_N	8.1e-41	150.3	Alpha-2-macroglobulin RAP, N-terminal domain
3	PF15317 Lbh	8.7e+02	12.1	Cardiac transcription factor regulator, Developmental protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000421922

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263816	0.996	Low-density lipoprotein receptor-related protein 2
2	9606.ENSP00000243077	0.994	Prolow-density lipoprotein receptor-related protein 1
3	9606.ENSP00000371532	0.991	Very low-density lipoprotein receptor
4	9606.ENSP00000361120	0.985	Ral guanine nucleotide dissociation stimulator
5	9606.ENSP00000303634	0.982	Low-density lipoprotein receptor-related protein 8
6	9606.ENSP00000444596	0.982	E3 ubiquitin-protein ligase MYCBP2
7	9606.ENSP00000395708	0.976	Rap guanine nucleotide exchange factor 3
8	9606.ENSP00000361263	0.975	Rap guanine nucleotide exchange factor 1
9	9606.ENSP00000260197	0.912	Sortilin-related receptor
10	9606.ENSP00000392423	0.910	Reelin
11	9606.ENSP00000380271	0.902	Rap guanine nucleotide exchange factor 4
12	9606.ENSP00000297261	0.900	Sonic hedgehog protein
13	9606.ENSP00000256637	0.881	Sortilin
14	9606.ENSP00000454071	0.808	Low-density lipoprotein receptor
15	9606.ENSP00000266980	0.782	Zinc transporter ZIP5
16	9606.ENSP00000302647	0.766	Ral GTPase-activating protein subunit alpha-1
17	9606.ENSP00000434033	0.760	Rap1 GTPase-activating protein 1
18	9606.ENSP00000245304	0.754	Ras-related protein Rap-2a
19	9606.ENSP00000005257	0.747	Ras-related protein Ral-A
20	9606.ENSP00000253193	0.745	Low-density lipoprotein receptor-related protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050750	1.000	low-density lipoprotein particle receptor binding
GO:0140677	0.976	molecular function activator activity
GO:0001540	0.959	amyloid-beta binding
GO:0030545	0.958	signaling receptor regulator activity
GO:0048018	0.954	receptor ligand activity
GO:0030547	0.925	signaling receptor inhibitor activity
GO:0070326	0.692	very-low-density lipoprotein particle receptor binding
GO:0048019	0.692	receptor antagonist activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0048518	0.972	positive regulation of biological process
GO:0007165	0.970	signal transduction
GO:0048523	0.968	negative regulation of cellular process
GO:0065009	0.959	regulation of molecular function
GO:0051128	0.955	regulation of cellular component organization
GO:0051179	0.954	localization
GO:0010646	0.945	regulation of cell communication
GO:0048583	0.942	regulation of response to stimulus
GO:0023051	0.936	regulation of signaling
GO:0051234	0.915	establishment of localization
GO:0009966	0.884	regulation of signal transduction
GO:0032501	0.825	multicellular organismal process
GO:0006810	0.824	transport
GO:0032879	0.762	regulation of localization
GO:0016192	0.745	vesicle-mediated transport
GO:0051098	0.729	regulation of binding
GO:0060627	0.718	regulation of vesicle-mediated transport
GO:0051129	0.694	negative regulation of cellular component organization
GO:0043393	0.688	regulation of protein binding
GO:0044092	0.667	negative regulation of molecular function
GO:0030100	0.632	regulation of endocytosis
GO:0048259	0.579	regulation of receptor-mediated endocytosis
GO:0051100	0.567	negative regulation of binding
GO:0002090	0.534	regulation of receptor internalization
GO:0048261	0.534	negative regulation of receptor-mediated endocytosis
GO:0010648	0.510	negative regulation of cell communication
GO:0032091	0.443	negative regulation of protein binding
GO:0051239	0.410	regulation of multicellular organismal process
GO:0048522	0.367	positive regulation of cellular process
GO:0010941	0.317	regulation of cell death
GO:0023057	0.311	negative regulation of signaling
GO:0048585	0.307	negative regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031982	0.999	vesicle
GO:0005791	0.999	rough endoplasmic reticulum
GO:0005788	0.999	endoplasmic reticulum lumen
GO:0005886	0.988	plasma membrane
GO:0005576	0.978	extracellular region
GO:0031410	0.954	cytoplasmic vesicle
GO:0005768	0.752	endosome
GO:0048237	0.724	rough endoplasmic reticulum lumen
GO:0005794	0.686	Golgi apparatus
GO:0005829	0.321	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]