StarFunc result for job id P30566

User Input

>input (484 residues)
MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDE
QIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTD
LIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLC
MDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITG
QTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMR
SERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISE
GLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGD
NDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKA
ELCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A096LNY6	0.997	0.969	2.158E-67	498	1.000	0.972	A0A096LNY6.pdb.gz	A0A096LNY6_HUMAN Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL PE=1 SV=2
2	AFDB:D3ZW08	0.987	0.987	1.044E-65	484	0.932	0.932	D3ZW08.pdb.gz	D3ZW08_RAT Adenylosuccinate lyase OS=Rattus norvegicus OX=10116 GN=Adsl PE=4 SV=2
3	AFDB:P21265	0.982	0.980	5.593E-62	485	0.831	0.829	P21265.pdb.gz	PUR8_CHICK Adenylosuccinate lyase OS=Gallus gallus OX=9031 GN=ADSL PE=2 SV=2
4	PDB:4flcB	0.942	0.982	1.861E-60	464	0.952	0.994	4flcB.pdb.gz
5	AFDB:Q05911	0.969	0.973	5.324E-51	482	0.626	0.629	Q05911.pdb.gz	PUR8_YEAST Adenylosuccinate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE13 PE=1 SV=1
6	AFDB:O60105	0.973	0.977	3.320E-50	482	0.610	0.612	O60105.pdb.gz	PUR8_SCHPO Adenylosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade8 PE=3 SV=1
7	AFDB:P71832	0.945	0.968	6.982E-32	472	0.302	0.309	P71832.pdb.gz	P71832_MYCTO Adenylosuccinate lyase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=purB PE=3 SV=2
8	AFDB:P12047	0.803	0.897	2.170E-25	431	0.248	0.278	P12047.pdb.gz	PUR8_BACSU Adenylosuccinate lyase OS=Bacillus subtilis (strain 168) OX=224308 GN=purB PE=1 SV=1
9	AFDB:O42889	0.790	0.851	1.335E-20	447	0.213	0.230	O42889.pdb.gz	YBN5_SCHPO Uncharacterized protein C8E4.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC8E4.05c PE=3 SV=1
10	AFDB:Q7KWJ4	0.779	0.799	1.297E-18	471	0.184	0.189	Q7KWJ4.pdb.gz	Q7KWJ4_PLAF7 Adenylosuccinate lyase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0206700 PE=3 SV=1
11	AFDB:Q8GUN7	0.717	0.664	1.772E-17	527	0.174	0.159	Q8GUN7.pdb.gz	Q8GUN7_ARATH Adenylosuccinate lyase OS=Arabidopsis thaliana OX=3702 GN=At1g36280 PE=1 SV=1
12	PDB:4efcA	0.710	0.756	2.261E-16	452	0.207	0.221	4efcA.pdb.gz	Crystal Structure of Adenylosuccinate Lyase from Trypanosoma Brucei, Tb427tmp.160.5560
13	PDB:2ptqA	0.764	0.803	2.467E-16	459	0.182	0.192	2ptqA.pdb.gz	Substrate and Product Complexes of Escherichia coli Adenylosuccinate Lyase Provide New Insights into the Enzymatic Mechanism.
14	PDB:1k62B	0.706	0.740	1.360E-14	459	0.178	0.187	1k62B.pdb.gz
15	PDB:1i0aA	0.709	0.753	1.631E-13	453	0.155	0.166	1i0aA.pdb.gz
16	PDB:1k7wD	0.696	0.744	2.028E-13	450	0.169	0.182	1k7wD.pdb.gz	Mutational analysis of duck delta 2 crystallin and the structure of an inactive mutant with bound substrate provide insight into the enzymatic mechanism of argininosuccinate lyase.
17	PDB:4apbD	0.656	0.684	2.752E-13	462	0.161	0.169	4apbD.pdb.gz	Conformational Changes Upon Ligand Binding in the Essential Class II Fumarase Rv1098C from Mycobacterium Tuberculosis.
18	PDB:7lubB	0.643	0.671	6.579E-13	462	0.169	0.177	7lubB.pdb.gz	Protein-metabolite interactomics of carbohydrate metabolism reveal regulation of lactate dehydrogenase.
19	PDB:6nzbA	0.670	0.700	2.654E-12	462	0.159	0.167	6nzbA.pdb.gz
20	PDB:1tj7A	0.683	0.723	2.772E-12	455	0.159	0.169	1tj7A.pdb.gz	Structure determination and refinement at 2.44 A resolution of argininosuccinate lyase from Escherichia coli.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096LNY6	0.0	999	498	1.000	0.972	A0A096LNY6_HUMAN Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL PE=1 SV=2
2	A0A0A6YY92	0.0	980	498	0.981	0.954	A0A0A6YY92_HUMAN Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL PE=1 SV=1
3	A0A1B0GWJ0	0.0	998	480	0.988	0.996	A0A1B0GWJ0_HUMAN Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL PE=1 SV=1
4	A0A8I5Y1I4	0.0	785	425	0.771	0.878	A0A8I5Y1I4_RAT Adenylosuccinate lyase OS=Rattus norvegicus OX=10116 GN=Adsl PE=1 SV=1
5	A0A8I5ZTN5	0.0	945	484	0.932	0.932	A0A8I5ZTN5_RAT Adenylosuccinate lyase OS=Rattus norvegicus OX=10116 GN=Adsl PE=3 SV=1
6	A0A8I6GJ79	0.0	907	469	0.903	0.932	A0A8I6GJ79_RAT Adenylosuccinate lyase OS=Rattus norvegicus OX=10116 GN=Adsl PE=1 SV=1
7	B4DP46	0.0	979	498	0.979	0.952	B4DP46_HUMAN Adenylosuccinate lyase OS=Homo sapiens OX=9606 PE=2 SV=1
8	D3ZW08	0.0	832	438	0.839	0.927	D3ZW08_RAT Adenylosuccinate lyase OS=Rattus norvegicus OX=10116 GN=Adsl PE=4 SV=2
9	O60105	0.0	613	482	0.607	0.610	PUR8_SCHPO Adenylosuccinate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade8 PE=3 SV=1
10	P21265	0.0	846	485	0.824	0.823	PUR8_CHICK Adenylosuccinate lyase OS=Gallus gallus OX=9031 GN=ADSL PE=2 SV=2
11	P30566	0.0	1010	484	1.000	1.000	PUR8_HUMAN Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL PE=1 SV=2
12	P54822	0.0	949	484	0.940	0.940	PUR8_MOUSE Adenylosuccinate lyase OS=Mus musculus OX=10090 GN=Adsl PE=1 SV=2
13	Q05911	0.0	629	482	0.624	0.627	PUR8_YEAST Adenylosuccinate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE13 PE=1 SV=1
14	X5D8S6	0.0	1010	484	1.000	1.000	X5D8S6_HUMAN Adenylosuccinate lyase (Fragment) OS=Homo sapiens OX=9606 GN=ADSL PE=2 SV=1
15	A0A8I6AM95	6.02e-85	260	164	0.248	0.732	A0A8I6AM95_RAT Adenylosuccinate lyase OS=Rattus norvegicus OX=10116 GN=Adsl PE=1 SV=1
16	P71832	1.79e-67	226	472	0.289	0.297	P71832_MYCTO Adenylosuccinate lyase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=purB PE=3 SV=2
17	P12047	1.42e-51	182	431	0.248	0.278	PUR8_BACSU Adenylosuccinate lyase OS=Bacillus subtilis (strain 168) OX=224308 GN=purB PE=1 SV=1
18	Q15247	1.21e-21	97.1	296	0.140	0.230	Q15247_HUMAN Adenylosuccinate lyase OS=Homo sapiens OX=9606 PE=2 SV=1
19	O42889	2.04e-16	83.6	447	0.221	0.239	YBN5_SCHPO Uncharacterized protein C8E4.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC8E4.05c PE=3 SV=1
20	Q38EJ2	8.11e-12	69.3	471	0.227	0.234	Q38EJ2_TRYB2 Adenylosuccinate lyase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5560 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10397 ADSL_C	1.8e-14	65.5	Adenylosuccinate lyase C-terminus
2	PF13318 AtzG-like	9.4	18.1	1-carboxybiuret hydrolase subunit AtzG-like
3	PF07048 DUF1331	2.4e+02	12.8	Protein of unknown function (DUF1331)
4	PF03221 HTH_Tnp_Tc5	1.4e+02	13.9	Tc5 transposase DNA-binding domain
5	PF00206 Lyase_1	1.9e-22	91.7	Lyase
6	PF09141 Talin_middle	2.6e+02	13.0	Talin, middle domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485525

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000236959	0.999	Bifunctional purine biosynthesis protein PURH
2	9606.ENSP00000355493	0.998	Adenylosuccinate synthetase isozyme 2
3	9606.ENSP00000333019	0.997	Adenylosuccinate synthetase isozyme 1
4	9606.ENSP00000382595	0.997	Multifunctional protein ADE2
5	9606.ENSP00000371253	0.996	Trifunctional purine biosynthetic protein adenosine-3
6	9606.ENSP00000367615	0.992	Adenine phosphoribosyltransferase
7	9606.ENSP00000286621	0.979	Adenosine kinase
8	9606.ENSP00000379802	0.970	AMP deaminase 3
9	9606.ENSP00000307188	0.967	Argininosuccinate lyase
10	9606.ENSP00000264220	0.965	Amidophosphoribosyltransferase
11	9606.ENSP00000430075	0.963	AMP deaminase 1
12	9606.ENSP00000256578	0.956	AMP deaminase 2
13	9606.ENSP00000346921	0.954	Adenylate kinase 2, mitochondrial
14	9606.ENSP00000339479	0.947	Cytosolic purine 5'-nucleotidase
15	9606.ENSP00000313490	0.941	Phosphoribosylformylglycinamidine synthase
16	9606.ENSP00000362271	0.935	Adenylate kinase isoenzyme 1
17	9606.ENSP00000371230	0.934	GTP:AMP phosphotransferase AK3, mitochondrial
18	9606.ENSP00000419851	0.934	GMP synthase [glutamine-hydrolyzing]
19	9606.ENSP00000378743	0.930	Adenylate kinase 4, mitochondrial
20	9606.ENSP00000352904	0.928	Cytosolic 5'-nucleotidase 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070626	1.000	(S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido) succinate lyase (fumarate-forming) activity
GO:0004018	1.000	N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity
GO:0042802	0.998	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:1901564	0.989	organonitrogen compound metabolic process
GO:0044281	0.986	small molecule metabolic process
GO:0006139	0.986	nucleobase-containing compound metabolic process
GO:0009168	0.979	purine ribonucleoside monophosphate biosynthetic process
GO:0009259	0.965	ribonucleotide metabolic process
GO:0009165	0.960	nucleotide biosynthetic process
GO:0009150	0.959	purine ribonucleotide metabolic process
GO:1901566	0.957	organonitrogen compound biosynthetic process
GO:1901137	0.955	carbohydrate derivative biosynthetic process
GO:0009152	0.948	purine ribonucleotide biosynthetic process
GO:0046033	0.932	AMP metabolic process
GO:0050896	0.374	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.698	organelle
GO:0043227	0.688	membrane-bounded organelle
GO:0043231	0.635	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23920	1.000	(2S)-2-[5-amino-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamido]succinate = 5-amino-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide + fumarate
RHEA:16853	1.000	N(6)-(1,2-dicarboxyethyl)-AMP = AMP + fumarate
EC:4.3.2.2	1.000	adenylosuccinate lyase.

[back to server]