StarFunc result for job id P30613

User Input

>input (574 residues)
MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQ
LPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEMIKAGMNIARLNFS
HGSHEYHAESIANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKG
SQVLVTVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQV
ENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGVDIVFASFVRKASDVAAVRAA
LGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVFLAQKMMIGRC
NLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGETAKGNFPVEAVKM
QHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRS
AQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESG
KLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12928	0.946	0.946	0.000	574	0.911	0.911	P12928.pdb.gz	KPYR_RAT Pyruvate kinase PKLR OS=Rattus norvegicus OX=10116 GN=Pklr PE=1 SV=2
2	PDB:6eckB	0.903	0.973	2.421E-96	532	0.855	0.923	6eckB.pdb.gz	Distinct Hepatic PKA and CDK Signaling Pathways Control Activity-Independent Pyruvate Kinase Phosphorylation and Hepatic Glucose Production.
3	PDB:4imaC	0.866	0.982	3.861E-92	505	0.871	0.990	4imaC.pdb.gz	Energetic Coupling between an Oxidizable Cysteine and the Phosphorylatable N-Terminus of Human Liver Pyruvate Kinase.
4	AFDB:P00548	0.904	0.978	3.276E-90	530	0.643	0.696	P00548.pdb.gz	KPYM_CHICK Pyruvate kinase PKM OS=Gallus gallus OX=9031 GN=PKM PE=2 SV=2
5	AFDB:A0A024R5Z9	0.903	0.976	7.856E-90	531	0.643	0.695	A0A024R5Z9.pdb.gz
6	AFDB:A8KC20	0.902	0.962	2.745E-88	538	0.629	0.671	A8KC20.pdb.gz
7	PDB:6nn7D	0.809	0.967	1.780E-82	479	0.821	0.983	6nn7D.pdb.gz
8	PDB:6gg3F	0.880	0.963	2.325E-81	524	0.653	0.716	6gg3F.pdb.gz	An allostatic mechanism for M2 pyruvate kinase as an amino-acid sensor.
9	AFDB:O62619	0.894	0.962	2.339E-80	533	0.533	0.574	O62619.pdb.gz	KPYK_DROME Pyruvate kinase OS=Drosophila melanogaster OX=7227 GN=PyK PE=2 SV=2
10	PDB:6v74C	0.857	0.985	8.126E-80	499	0.629	0.723	6v74C.pdb.gz	Biochemical and structural insights into how amino acids regulate pyruvate kinase muscle isoform 2.
11	PDB:4imaD	0.781	0.972	4.397E-78	460	0.786	0.980	4imaD.pdb.gz	Energetic Coupling between an Oxidizable Cysteine and the Phosphorylatable N-Terminus of Human Liver Pyruvate Kinase.
12	AFDB:Q23539	0.872	0.971	1.004E-76	515	0.497	0.553	Q23539.pdb.gz	Q23539_CAEEL Pyruvate kinase OS=Caenorhabditis elegans OX=6239 GN=pyk-2 PE=1 SV=2
13	PDB:6nu1B	0.774	0.981	4.443E-71	452	0.585	0.743	6nu1B.pdb.gz	Mechanistic and Structural Insights into Cysteine-Mediated Inhibition of Pyruvate Kinase Muscle Isoform 2.
14	AFDB:Q10208	0.836	0.941	5.596E-71	509	0.456	0.515	Q10208.pdb.gz	KPYK_SCHPO Pyruvate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pyk1 PE=1 SV=1
15	PDB:6nn8D	0.720	0.979	6.514E-71	421	0.730	0.995	6nn8D.pdb.gz
16	AFDB:P46614	0.856	0.973	4.720E-70	504	0.437	0.498	P46614.pdb.gz	KPYK_CANAL Pyruvate kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC19 PE=1 SV=3
17	PDB:6gg3E	0.794	0.945	1.181E-69	481	0.617	0.736	6gg3E.pdb.gz	An allostatic mechanism for M2 pyruvate kinase as an amino-acid sensor.
18	AFDB:Q6FIS9	0.849	0.971	1.334E-69	501	0.430	0.493	Q6FIS9.pdb.gz	KPYK1_CANGA Pyruvate kinase 1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=PYK1 PE=3 SV=1
19	AFDB:P52489	0.855	0.968	2.065E-69	506	0.441	0.500	P52489.pdb.gz	KPYK2_YEAST Pyruvate kinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PYK2 PE=1 SV=1
20	PDB:6v76D	0.741	0.987	3.481E-67	431	0.563	0.749	6v76D.pdb.gz	Biochemical and structural insights into how amino acids regulate pyruvate kinase muscle isoform 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YT36	0.0	581	513	0.497	0.556	D3YT36_CAEEL Pyruvate kinase OS=Caenorhabditis elegans OX=6239 GN=pyk-2 PE=1 SV=1
2	D3YT37	0.0	546	461	0.463	0.577	D3YT37_CAEEL Pyruvate kinase OS=Caenorhabditis elegans OX=6239 GN=pyk-2 PE=1 SV=1
3	H3BTN5	0.0	719	485	0.594	0.703	H3BTN5_HUMAN Pyruvate kinase (Fragment) OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=1
4	O62619	0.0	615	533	0.533	0.574	KPYK_DROME Pyruvate kinase OS=Drosophila melanogaster OX=7227 GN=PyK PE=2 SV=2
5	P00548	0.0	787	530	0.643	0.696	KPYM_CHICK Pyruvate kinase PKM OS=Gallus gallus OX=9031 GN=PKM PE=2 SV=2
6	P11974	0.0	774	531	0.631	0.682	KPYM_RABIT Pyruvate kinase PKM OS=Oryctolagus cuniculus OX=9986 GN=PKM PE=1 SV=4
7	P11980	0.0	774	531	0.641	0.693	KPYM_RAT Pyruvate kinase PKM OS=Rattus norvegicus OX=10116 GN=Pkm PE=1 SV=3
8	P12928	0.0	1070	574	0.911	0.911	KPYR_RAT Pyruvate kinase PKLR OS=Rattus norvegicus OX=10116 GN=Pklr PE=1 SV=2
9	P14618	0.0	799	531	0.655	0.708	KPYM_HUMAN Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4
10	P30613	0.0	1165	574	1.000	1.000	KPYR_HUMAN Pyruvate kinase PKLR OS=Homo sapiens OX=9606 GN=PKLR PE=1 SV=2
11	P52480	0.0	775	531	0.650	0.702	KPYM_MOUSE Pyruvate kinase PKM OS=Mus musculus OX=10090 GN=Pkm PE=1 SV=4
12	P53657	0.0	1071	574	0.916	0.916	KPYR_MOUSE Pyruvate kinase PKLR OS=Mus musculus OX=10090 GN=Pklr PE=1 SV=1
13	Q23539	0.0	582	515	0.497	0.553	Q23539_CAEEL Pyruvate kinase OS=Caenorhabditis elegans OX=6239 GN=pyk-2 PE=1 SV=2
14	Q7SXK3	0.0	764	538	0.629	0.671	Q7SXK3_DANRE Pyruvate kinase OS=Danio rerio OX=7955 GN=wu:fi37e08 PE=1 SV=1
15	V9HWB8	0.0	799	531	0.655	0.708	V9HWB8_HUMAN Pyruvate kinase OS=Homo sapiens OX=9606 GN=HEL-S-30 PE=1 SV=1
16	P46614	1.84e-177	513	504	0.437	0.498	KPYK_CANAL Pyruvate kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC19 PE=1 SV=3
17	Q10208	2.00e-177	513	509	0.460	0.519	KPYK_SCHPO Pyruvate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pyk1 PE=1 SV=1
18	P52489	2.15e-167	487	506	0.443	0.502	KPYK2_YEAST Pyruvate kinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PYK2 PE=1 SV=1
19	P00549	2.75e-166	484	500	0.425	0.488	KPYK1_YEAST Pyruvate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC19 PE=1 SV=2
20	Q6FV12	3.21e-164	479	508	0.422	0.476	KPYK2_CANGA Pyruvate kinase 2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=PYK2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03328 HpcH_HpaI	1.1e+02	13.4	HpcH/HpaI aldolase/citrate lyase family
2	PF00478 IMPDH	5.5	17.5	IMP dehydrogenase / GMP reductase domain
3	PF00224 PK	1.3e-162	552.2	Pyruvate kinase, barrel domain
4	PF02887 PK_C	7.5e-28	108.5	Pyruvate kinase, alpha/beta domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339933

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345555	0.986	Enolase 4
2	9606.ENSP00000405573	0.986	Glucose-6-phosphate isomerase
3	9606.ENSP00000234590	0.985	Alpha-enolase
4	9606.ENSP00000324105	0.985	Beta-enolase
5	9606.ENSP00000437402	0.980	Gamma-enolase
6	9606.ENSP00000377532	0.975	Pyruvate carboxylase, mitochondrial
7	9606.ENSP00000319814	0.970	Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
8	9606.ENSP00000358719	0.965	Malic enzyme 1
9	9606.ENSP00000440246	0.965	NADP-dependent malic enzyme, mitochondrial
10	9606.ENSP00000216780	0.963	Phosphoenolpyruvate carboxykinase [GTP], mitochondrial
11	9606.ENSP00000320886	0.961	Carbohydrate-responsive element-binding protein
12	9606.ENSP00000229270	0.956	Triosephosphate isomerase 1
13	9606.ENSP00000307241	0.956	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
14	9606.ENSP00000369134	0.954	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
15	9606.ENSP00000257555	0.952	Hepatocyte nuclear factor 1-alpha
16	9606.ENSP00000473348	0.952	GDH/6PGL endoplasmic bifunctional protein
17	9606.ENSP00000363988	0.950	Belongs to the class I fructose-bisphosphate aldolase family
18	9606.ENSP00000377192	0.949	Glucose-6-phosphate 1-dehydrogenase
19	9606.ENSP00000321070	0.946	NAD-dependent malic enzyme, mitochondrial
20	9606.ENSP00000378669	0.940	Fructose-bisphosphate aldolase A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004743	0.999	pyruvate kinase activity
GO:0005515	0.995	protein binding
GO:0097159	0.673	organic cyclic compound binding
GO:1901363	0.672	heterocyclic compound binding
GO:0003723	0.636	RNA binding
GO:0042802	0.473	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0071704	0.941	organic substance metabolic process
GO:0044238	0.920	primary metabolic process
GO:0044237	0.918	cellular metabolic process
GO:0050896	0.902	response to stimulus
GO:0006807	0.880	nitrogen compound metabolic process
GO:0034641	0.704	cellular nitrogen compound metabolic process
GO:1901564	0.641	organonitrogen compound metabolic process
GO:0044281	0.630	small molecule metabolic process
GO:0009058	0.581	biosynthetic process
GO:1901360	0.556	organic cyclic compound metabolic process
GO:0006139	0.550	nucleobase-containing compound metabolic process
GO:0006796	0.535	phosphate-containing compound metabolic process
GO:1901576	0.516	organic substance biosynthetic process
GO:0044419	0.497	biological process involved in interspecies interaction between organisms
GO:0006163	0.475	purine nucleotide metabolic process
GO:1901135	0.431	carbohydrate derivative metabolic process
GO:0009605	0.430	response to external stimulus
GO:0044249	0.419	cellular biosynthetic process
GO:0043436	0.398	oxoacid metabolic process
GO:0019752	0.388	carboxylic acid metabolic process
GO:0044271	0.373	cellular nitrogen compound biosynthetic process
GO:0065007	0.368	biological regulation
GO:0050789	0.338	regulation of biological process
GO:0009150	0.322	purine ribonucleotide metabolic process
GO:0006091	0.300	generation of precursor metabolites and energy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043226	0.977	organelle
GO:0043227	0.972	membrane-bounded organelle
GO:0016020	0.907	membrane
GO:0070013	0.883	intracellular organelle lumen
GO:0005576	0.881	extracellular region
GO:0070062	0.870	extracellular exosome
GO:0043231	0.844	intracellular membrane-bounded organelle
GO:0031981	0.340	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18159	0.999	ADP + H(+) + phosphoenolpyruvate => ATP + pyruvate
EC:2.7.1.40	0.999	pyruvate kinase.

[back to server]