StarFunc result for job id P30622

User Input

>input (1438 residues)
MSMLKPSGLKAPTKILKPGSTALKTPTAVVAPVEKTISSEKASSTPSSETQEEFVDDFRV
GERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTR
PSKLTRKVQAEDEANGLQTTPASRATSPLCTSTASMVSSSPSTPSNIPQKPSQPAAKEPS
ATPPISNLTKTASESISNLSEAGSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGE
WCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKANAVRRVM
ATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSSRYARKISGTTALQEALKEK
QQHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAA
DREKVELLNQLEEEKRKVEDLQFRVEEESITKGDLEQKSQISEDPENTQTKLEHARIKEL
EQSLLFEKTKADKLQRELEDTRVATVSEKSRIMELEKDLALRVQEVAELRRRLESNKPAG
DVDMSLSLLQEISSLQEKLEVTRTDHQREITSLKEHFGAREETHQKEIKALYTATEKLSK
ENESLKSKLEHANKENSDVIALWKSKLETAIASHQQAMEELKVSFSKGLGTETAEFAELK
TQIEKMRLDYQHEIENLQNQQDSERAAHAKEMEALRAKLMKVIKEKENSLEAIRSKLDKA
EDQHLVEMEDTLNKLQEAEIKVKELEVLQAKCNEQTKVIDNFTSQLKATEEKLLDLDALR
KASSEGKSEMKKLRQQLEAAEKQIKHLEIEKNAESSKASSITRELQGRELKLTNLQENLS
EVSQVKETLEKELQILKEKFAEASEEAVSVQRSMQETVNKLHQKEEQFNMLSSDLEKLRE
NLADMEAKFREKDEREEQLIKAKEKLENDIAEIMKMSGDNSSQLTKMNDELRLKERDVEE
LQLKLTKANENASFLQKSIEDMTVKAEQSQQEAAKKHEEEKKELERKLSDLEKKMETSHN
QCQELKARYERATSETKTKHEEILQNLQKTLLDTEDKLKGAREENSGLLQELEELRKQAD
KAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAKLQNELDTLKENNLKNVEELNKS
KELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEENVKLAEELGRSRDEVTSHQKLE
EERSVLNNQLLEMKKRESKFIKDADEEKASLQKSISITSALLTEKDAELEKLRNEVTVLR
GENASAKSLHSVVQTLESDKVKLELKVKNLELQLKENKRQLSSSSGNTDTQADEDERAQE
SQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCD
ICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDETF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30622	1.000	1.000	0.000	1438	1.000	1.000	P30622.pdb.gz	CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2
2	AFDB:Q922J3	0.126	0.130	0.000	1391	0.867	0.896	Q922J3.pdb.gz	CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus OX=10090 GN=Clip1 PE=1 SV=1
3	AFDB:Q9JK25	0.092	0.099	0.000	1320	0.832	0.907	Q9JK25.pdb.gz	CLIP1_RAT CAP-Gly domain-containing linker protein 1 OS=Rattus norvegicus OX=10116 GN=Clip1 PE=1 SV=2
4	AFDB:E7F2X0	0.150	0.139	5.299E-76	1569	0.492	0.451	E7F2X0.pdb.gz	E7F2X0_DANRE CAP-GLY domain-containing linker protein 1a OS=Danio rerio OX=7955 GN=clip1a PE=1 SV=2
5	AFDB:Q9Z0H8	0.123	0.162	4.239E-54	1047	0.326	0.448	Q9Z0H8.pdb.gz	CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus OX=10090 GN=Clip2 PE=1 SV=2
6	AFDB:Q9VJE5	0.101	0.088	5.353E-36	1690	0.280	0.238	Q9VJE5.pdb.gz	CL190_DROME Restin homolog OS=Drosophila melanogaster OX=7227 GN=CLIP-190 PE=1 SV=1
7	AFDB:Q8N3C7	0.052	0.105	4.755E-19	705	0.080	0.163	Q8N3C7.pdb.gz	CLIP4_HUMAN CAP-Gly domain-containing linker protein 4 OS=Homo sapiens OX=9606 GN=CLIP4 PE=1 SV=1
8	AFDB:A0A024R370	0.060	0.077	6.753E-5	1093	0.120	0.158	A0A024R370.pdb.gz
9	AFDB:Q5JR59	0.065	0.068	7.146E-5	1369	0.086	0.091	Q5JR59.pdb.gz	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3
10	AFDB:B9EK46	0.103	0.120	1.123E-4	1203	0.150	0.180	B9EK46.pdb.gz	B9EK46_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=1
11	PDB:7n6g3I	0.064	0.205	9.837E-3	401	0.034	0.122	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
12	PDB:7sqcO1	0.065	0.131	2.169E-2	673	0.031	0.065	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
13	PDB:6acaA	0.032	0.040	3.865E-1	1133	0.006	0.008	6acaA.pdb.gz
14	PDB:4v8mBU	0.035	0.220	4.327E-1	158	0.013	0.114	4v8mBU.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
15	PDB:2eyqA	0.033	0.040	4.844E-1	1146	0.008	0.010	2eyqA.pdb.gz
16	PDB:3hksA	0.022	0.170	8.054E-1	144	0.003	0.035	3hksA.pdb.gz
17	PDB:5gakq	0.027	0.175	8.522E-1	154	0.006	0.052	5gakq.pdb.gz	Structure of the hypusinylated eukaryotic translation factor eIF-5A bound to the ribosome.
18	PDB:7oydt	0.026	0.193	9.017E-1	126	0.006	0.071	7oydt.pdb.gz	A molecular network of conserved factors keeps ribosomes dormant in the egg.
19	PDB:3ajwA	0.072	0.644	1.068	134	0.010	0.112	3ajwA.pdb.gz
20	PDB:6z6oC	0.056	0.118	1.130	548	0.019	0.049	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F2X0	0.0	989	1569	0.435	0.398	E7F2X0_DANRE CAP-GLY domain-containing linker protein 1a OS=Danio rerio OX=7955 GN=clip1a PE=1 SV=2
2	O55156	0.0	751	1046	0.326	0.448	CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS=Rattus norvegicus OX=10116 GN=Clip2 PE=1 SV=1
3	P30622	0.0	2905	1438	1.000	1.000	CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2
4	Q922J3	0.0	2398	1391	0.869	0.898	CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus OX=10090 GN=Clip1 PE=1 SV=1
5	Q9JK25	0.0	1735	1320	0.691	0.753	CLIP1_RAT CAP-Gly domain-containing linker protein 1 OS=Rattus norvegicus OX=10116 GN=Clip1 PE=1 SV=2
6	Q9UDT6	0.0	773	1046	0.332	0.456	CLIP2_HUMAN CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2 PE=1 SV=1
7	Q9Z0H8	0.0	767	1047	0.330	0.454	CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus OX=10090 GN=Clip2 PE=1 SV=2
8	Q9VJE5	3.99e-72	269	1690	0.115	0.098	CL190_DROME Restin homolog OS=Drosophila melanogaster OX=7227 GN=CLIP-190 PE=1 SV=1
9	Q96DZ5	2.22e-45	175	547	0.067	0.176	CLIP3_HUMAN CAP-Gly domain-containing linker protein 3 OS=Homo sapiens OX=9606 GN=CLIP3 PE=1 SV=3
10	B9EHT4	4.29e-43	168	547	0.069	0.181	CLIP3_MOUSE CAP-Gly domain-containing linker protein 3 OS=Mus musculus OX=10090 GN=Clip3 PE=1 SV=1
11	Q8N3C7	7.62e-33	139	705	0.063	0.128	CLIP4_HUMAN CAP-Gly domain-containing linker protein 4 OS=Homo sapiens OX=9606 GN=CLIP4 PE=1 SV=1
12	B5MCH3	1.08e-22	106	571	0.033	0.084	B5MCH3_HUMAN CAP-Gly domain containing linker protein family member 4 OS=Homo sapiens OX=9606 GN=CLIP4 PE=1 SV=1
13	Q5VT06	6.34e-21	103	3117	0.026	0.012	CE350_HUMAN Centrosome-associated protein 350 OS=Homo sapiens OX=9606 GN=CEP350 PE=1 SV=1
14	E9Q309	2.56e-20	100	3095	0.026	0.012	CE350_MOUSE Centrosome-associated protein 350 OS=Mus musculus OX=10090 GN=Cep350 PE=1 SV=1
15	Q9NQT8	2.57e-18	94.4	1826	0.031	0.024	KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2
16	E9Q4K7	1.84e-17	91.7	1843	0.024	0.018	E9Q4K7_MOUSE Kinesin family member 13B OS=Mus musculus OX=10090 GN=Kif13b PE=1 SV=1
17	A0A0G2K8Z9	1.86e-17	91.7	1815	0.024	0.019	A0A0G2K8Z9_RAT Kinesin family member 13B OS=Rattus norvegicus OX=10116 GN=Kif13b PE=1 SV=2
18	O01349	1.99e-16	88.2	1921	0.024	0.018	O01349_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=2 SV=1
19	Q9D1E6	2.09e-16	82.8	244	0.029	0.168	TBCB_MOUSE Tubulin-folding cofactor B OS=Mus musculus OX=10090 GN=Tbcb PE=1 SV=2
20	A1ZA18	3.22e-16	87.4	1921	0.023	0.017	A1ZA18_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01302 CAP_GLY	9.5e-45	161.7	CAP-Gly domain
2	PF16641 CLIP1_ZNF	9.4e-12	55.8	CLIP1 zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479322

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380378	0.999	Platelet-activating factor acetylhydrolase IB subunit alpha
2	9606.ENSP00000354791	0.998	Dynactin subunit 1
3	9606.ENSP00000268182	0.997	Ras GTPase-activating-like protein IQGAP1
4	9606.ENSP00000364721	0.994	Microtubule-associated protein RP/EB family member 1
5	9606.ENSP00000354558	0.977	Serine/threonine-protein kinase mTOR
6	9606.ENSP00000383118	0.976	Cell division control protein 42 homolog
7	9606.ENSP00000408910	0.974	Dynactin subunit 2
8	9606.ENSP00000417518	0.973	CLIP-associating protein 2
9	9606.ENSP00000233121	0.968	Microtubule-associated protein RP/EB family member 3
10	9606.ENSP00000301071	0.947	Tubulin alpha-1A chain
11	9606.ENSP00000221114	0.941	Dynactin subunit 6
12	9606.ENSP00000259632	0.941	Dynactin subunit 3
13	9606.ENSP00000261383	0.933	Dynein heavy chain 3, axonemal
14	9606.ENSP00000265104	0.933	Dynein heavy chain 5, axonemal
15	9606.ENSP00000333363	0.933	Dynein heavy chain 8, axonemal
16	9606.ENSP00000374045	0.933	Dynein heavy chain 6, axonemal
17	9606.ENSP00000401514	0.933	Dynein heavy chain 1, axonemal
18	9606.ENSP00000316779	0.932	Myc box-dependent-interacting protein 1
19	9606.ENSP00000263710	0.920	CLIP-associating protein 1
20	9606.ENSP00000307272	0.913	Regulatory-associated protein of mTOR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051010	1.000	microtubule plus-end binding
GO:0042802	0.964	identical protein binding
GO:0008270	0.905	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071840	0.986	cellular component organization or biogenesis
GO:0050794	0.983	regulation of cellular process
GO:0016043	0.982	cellular component organization
GO:0033043	0.937	regulation of organelle organization
GO:0051493	0.897	regulation of cytoskeleton organization
GO:0032886	0.896	regulation of microtubule-based process
GO:0070507	0.882	regulation of microtubule cytoskeleton organization
GO:0048522	0.880	positive regulation of cellular process
GO:0044087	0.879	regulation of cellular component biogenesis
GO:1902903	0.877	regulation of supramolecular fiber organization
GO:0006996	0.852	organelle organization
GO:0031110	0.846	regulation of microtubule polymerization or depolymerization
GO:0007017	0.841	microtubule-based process
GO:0043254	0.810	regulation of protein-containing complex assembly
GO:0032271	0.785	regulation of protein polymerization
GO:0000226	0.778	microtubule cytoskeleton organization
GO:0051495	0.762	positive regulation of cytoskeleton organization
GO:0032273	0.744	positive regulation of protein polymerization
GO:0031112	0.722	positive regulation of microtubule polymerization or depolymerization
GO:1902905	0.708	positive regulation of supramolecular fiber organization
GO:0031113	0.625	regulation of microtubule polymerization
GO:0051179	0.608	localization
GO:0007049	0.571	cell cycle
GO:0051641	0.463	cellular localization
GO:0000278	0.461	mitotic cell cycle
GO:0051234	0.457	establishment of localization
GO:0031116	0.384	positive regulation of microtubule polymerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0035371	0.998	microtubule plus-end
GO:0005737	0.991	cytoplasm
GO:0005829	0.978	cytosol
GO:0005634	0.874	nucleus
GO:0016020	0.761	membrane
GO:0005815	0.726	microtubule organizing center
GO:0005694	0.697	chromosome
GO:0005813	0.689	centrosome
GO:0098687	0.649	chromosomal region
GO:0031982	0.639	vesicle
GO:0000775	0.637	chromosome, centromeric region
GO:0000793	0.630	condensed chromosome
GO:0031410	0.622	cytoplasmic vesicle
GO:0000779	0.616	condensed chromosome, centromeric region
GO:0000776	0.614	kinetochore
GO:0005768	0.525	endosome
GO:0044354	0.409	macropinosome
GO:0005882	0.401	intermediate filament
GO:0043233	0.300	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]