StarFunc result for job id P30626

User Input

>input (198 residues)
MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQ
SGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTV
DPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQ
QGVVNFPYDDFIQCVMSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0BNJ1	0.854	0.854	5.313E-29	198	0.919	0.919	B0BNJ1.pdb.gz	B0BNJ1_RAT LOC683667 protein OS=Rattus norvegicus OX=10116 GN=Sri PE=2 SV=1
2	PDB:4uslA	0.703	0.788	2.544E-22	173	0.874	1.000	4uslA.pdb.gz	Structural Basis of Sorcin-Mediated Calcium-Dependent Signal Transduction.
3	AFDB:Q8VC88	0.848	0.765	4.471E-21	220	0.606	0.545	Q8VC88.pdb.gz	GRAN_MOUSE Grancalcin OS=Mus musculus OX=10090 GN=Gca PE=1 SV=1
4	AFDB:P28676	0.842	0.769	1.933E-20	217	0.586	0.535	P28676.pdb.gz	GRAN_HUMAN Grancalcin OS=Homo sapiens OX=9606 GN=GCA PE=1 SV=2
5	AFDB:B4DHQ6	0.406	0.488	1.734E-18	158	0.798	1.000	B4DHQ6.pdb.gz	B4DHQ6_HUMAN Sorcin OS=Homo sapiens OX=9606 GN=SRI PE=1 SV=1
6	AFDB:E9QE31	0.776	0.220	2.744E-12	723	0.288	0.079	E9QE31.pdb.gz	E9QE31_DANRE Calpain-3 OS=Danio rerio OX=7955 GN=si:dkey-12h9.9 PE=3 SV=2
7	AFDB:A0A2R8Q1U8	0.772	0.227	4.629E-12	715	0.288	0.080	A0A2R8Q1U8.pdb.gz
8	AFDB:P16259	0.791	0.202	1.711E-11	821	0.298	0.072	P16259.pdb.gz	CAN3_RAT Calpain-3 OS=Rattus norvegicus OX=10116 GN=Capn3 PE=2 SV=1
9	AFDB:A8Y589	0.595	0.650	3.557E-11	178	0.338	0.376	A8Y589.pdb.gz	A8Y589_DROME Apoptosis-linked gene-2 OS=Drosophila melanogaster OX=7227 GN=Alg-2 PE=1 SV=2
10	AFDB:Q9VT65	0.773	0.176	5.129E-11	925	0.328	0.070	Q9VT65.pdb.gz	CANB_DROME Calpain-B OS=Drosophila melanogaster OX=7227 GN=CalpB PE=1 SV=2
11	AFDB:Q9UMQ6	0.765	0.215	7.020E-11	739	0.258	0.069	Q9UMQ6.pdb.gz	CAN11_HUMAN Calpain-11 OS=Homo sapiens OX=9606 GN=CAPN11 PE=2 SV=2
12	PDB:1hqvA	0.575	0.626	9.675E-10	178	0.338	0.376	1hqvA.pdb.gz	Structure of apoptosis-linked protein ALG-2: insights into Ca2+-induced changes in penta-EF-hand proteins.
13	PDB:1kfuL	0.760	0.227	1.632E-9	699	0.283	0.080	1kfuL.pdb.gz
14	PDB:1kfxL	0.733	0.238	2.608E-8	640	0.273	0.084	1kfxL.pdb.gz
15	PDB:5d43A	0.309	0.395	4.608E-5	150	0.152	0.200	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
16	PDB:2f2pA	0.275	0.316	7.001E-5	169	0.157	0.183	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
17	PDB:3fwbA	0.287	0.365	1.244E-4	153	0.121	0.157	3fwbA.pdb.gz
18	PDB:1a2xA	0.287	0.353	1.794E-4	158	0.152	0.190	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
19	PDB:3wfnB	0.292	0.332	1.794E-4	169	0.167	0.195	3wfnB.pdb.gz
20	PDB:1ggzA	0.279	0.364	2.873E-4	144	0.182	0.250	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30626	1.19e-148	412	198	1.000	1.000	SORCN_HUMAN Sorcin OS=Homo sapiens OX=9606 GN=SRI PE=1 SV=1
2	A0A8I5ZWU9	2.28e-125	352	183	0.838	0.907	A0A8I5ZWU9_RAT Sorcin OS=Rattus norvegicus OX=10116 GN=Sri PE=1 SV=1
3	A0A8I6AU02	2.48e-125	353	203	0.838	0.818	A0A8I6AU02_RAT Sorcin OS=Rattus norvegicus OX=10116 GN=Sri PE=1 SV=1
4	A0A8I5ZTT7	2.57e-125	352	182	0.838	0.912	A0A8I5ZTT7_RAT Sorcin OS=Rattus norvegicus OX=10116 GN=Sri PE=1 SV=1
5	P05044	2.61e-125	353	198	0.949	0.949	SORCN_CRIGR Sorcin OS=Cricetulus griseus OX=10029 GN=SRI PE=1 SV=1
6	Q6P069	4.94e-125	352	198	0.960	0.960	SORCN_MOUSE Sorcin OS=Mus musculus OX=10090 GN=Sri PE=1 SV=1
7	B0BNJ1	8.55e-122	344	198	0.919	0.919	B0BNJ1_RAT LOC683667 protein OS=Rattus norvegicus OX=10116 GN=Sri PE=2 SV=1
8	A0A8I5Y9M9	4.72e-115	328	235	0.889	0.749	A0A8I5Y9M9_RAT Sorcin OS=Rattus norvegicus OX=10116 GN=Sri PE=1 SV=1
9	B4DHQ6	1.50e-108	309	158	0.798	1.000	B4DHQ6_HUMAN Sorcin OS=Homo sapiens OX=9606 GN=SRI PE=1 SV=1
10	M0RAF3	8.25e-102	293	182	0.798	0.868	M0RAF3_RAT Sorcin OS=Rattus norvegicus OX=10116 GN=Sri PE=1 SV=1
11	Q8VC88	1.13e-87	259	220	0.596	0.536	GRAN_MOUSE Grancalcin OS=Mus musculus OX=10090 GN=Gca PE=1 SV=1
12	P28676	5.77e-84	249	217	0.616	0.562	GRAN_HUMAN Grancalcin OS=Homo sapiens OX=9606 GN=GCA PE=1 SV=2
13	H7BXD5	1.62e-82	245	198	0.561	0.561	H7BXD5_HUMAN Grancalcin OS=Homo sapiens OX=9606 GN=GCA PE=1 SV=1
14	H7C2Z6	1.21e-56	177	146	0.394	0.534	H7C2Z6_HUMAN Grancalcin (Fragment) OS=Homo sapiens OX=9606 GN=GCA PE=1 SV=1
15	A8Y589	1.85e-37	129	178	0.338	0.376	A8Y589_DROME Apoptosis-linked gene-2 OS=Drosophila melanogaster OX=7227 GN=Alg-2 PE=1 SV=2
16	Q7K2L7	3.03e-34	122	199	0.293	0.291	Q7K2L7_DROME GH27120p OS=Drosophila melanogaster OX=7227 GN=Pef PE=1 SV=1
17	Q9UBV8	5.07e-32	119	284	0.338	0.236	PEF1_HUMAN Peflin OS=Homo sapiens OX=9606 GN=PEF1 PE=1 SV=1
18	Q5PQ53	6.47e-32	118	283	0.323	0.226	PEF1_XENLA Peflin OS=Xenopus laevis OX=8355 GN=pef1 PE=1 SV=1
19	C9JWQ8	8.03e-32	114	146	0.253	0.342	C9JWQ8_HUMAN Grancalcin (Fragment) OS=Homo sapiens OX=9606 GN=GCA PE=1 SV=8
20	Q9VT65	1.19e-31	122	925	0.333	0.071	CANB_DROME Calpain-B OS=Drosophila melanogaster OX=7227 GN=CalpB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05042 Caleosin	1.9e+02	13.4	Caleosin related protein
2	PF12965 DUF3854	6.7e+02	11.6	Domain of unknown function (DUF3854)
3	PF00036 EF-hand_1	1.1e-12	57.6	EF hand
4	PF13202 EF-hand_5	8.5e-08	42.5	EF hand
5	PF13405 EF-hand_6	1.4e-11	54.3	EF-hand domain
6	PF13499 EF-hand_7	2.9e-10	51.8	EF-hand domain pair
7	PF13833 EF-hand_8	2.2e-10	51.5	EF-hand domain pair
8	PF05099 TerB	2.5e+02	13.4	Tellurite resistance protein TerB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265729

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362010	0.992	Annexin A7
2	9606.ENSP00000355533	0.982	Ryanodine receptor 2
3	9606.ENSP00000355747	0.980	Presenilin-2
4	9606.ENSP00000450527	0.769	Homeodomain-only protein
5	9606.ENSP00000411825	0.751	Programmed cell death 6-interacting protein
6	9606.ENSP00000238616	0.726	Serine/threonine-protein kinase Nek9
7	9606.ENSP00000268766	0.721	Serine/threonine-protein kinase Nek8
8	9606.ENSP00000338345	0.692	Alpha-synuclein
9	9606.ENSP00000367851	0.678	Cytochrome b-245 heavy chain
10	9606.ENSP00000346173	0.661	Electron transfer flavoprotein subunit beta
11	9606.ENSP00000264335	0.651	14-3-3 protein epsilon
12	9606.ENSP00000215909	0.645	Galectin-1
13	9606.ENSP00000439281	0.645	Triadin
14	9606.ENSP00000369786	0.635	Pirin
15	9606.ENSP00000370373	0.601	Peptidyl-prolyl cis-trans isomerase FKBP1B
16	9606.ENSP00000373884	0.582	Ryanodine receptor 3
17	9606.ENSP00000368767	0.580	Aspartyl/asparaginyl beta-hydroxylase
18	9606.ENSP00000398610	0.576	Annexin A11
19	9606.ENSP00000266376	0.575	Voltage-dependent L-type calcium channel subunit alpha-1C
20	9606.ENSP00000300093	0.575	Serine/threonine-protein kinase PLK1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005509	0.999	calcium ion binding
GO:0046983	0.473	protein dimerization activity
GO:0003824	0.443	catalytic activity
GO:0019899	0.403	enzyme binding
GO:0042802	0.384	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.980	regulation of biological process
GO:0009987	0.956	cellular process
GO:0050794	0.955	regulation of cellular process
GO:0034765	0.877	regulation of monoatomic ion transmembrane transport
GO:0010959	0.873	regulation of metal ion transport
GO:1904062	0.872	regulation of monoatomic cation transmembrane transport
GO:0048518	0.849	positive regulation of biological process
GO:0048522	0.806	positive regulation of cellular process
GO:0051179	0.734	localization
GO:0065009	0.680	regulation of molecular function
GO:0050896	0.661	response to stimulus
GO:0032501	0.655	multicellular organismal process
GO:0051234	0.624	establishment of localization
GO:0032502	0.618	developmental process
GO:0048856	0.614	anatomical structure development
GO:0048519	0.559	negative regulation of biological process
GO:0048523	0.548	negative regulation of cellular process
GO:0019222	0.492	regulation of metabolic process
GO:0060255	0.462	regulation of macromolecule metabolic process
GO:0051716	0.456	cellular response to stimulus
GO:0051924	0.410	regulation of calcium ion transport
GO:0007275	0.367	multicellular organism development
GO:0031323	0.363	regulation of cellular metabolic process
GO:0080090	0.358	regulation of primary metabolic process
GO:0032409	0.356	regulation of transporter activity
GO:0006810	0.354	transport
GO:0008152	0.338	metabolic process
GO:0051050	0.333	positive regulation of transport
GO:0051171	0.331	regulation of nitrogen compound metabolic process
GO:0048513	0.320	animal organ development
GO:0048731	0.306	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0005829	0.998	cytosol
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0071944	0.995	cell periphery
GO:0005886	0.983	plasma membrane
GO:0099080	0.979	supramolecular complex
GO:0099512	0.974	supramolecular fiber
GO:0005576	0.973	extracellular region
GO:0030018	0.960	Z disc
GO:0005615	0.943	extracellular space
GO:0031982	0.937	vesicle
GO:0005634	0.932	nucleus
GO:0005783	0.930	endoplasmic reticulum
GO:1903561	0.913	extracellular vesicle
GO:0070062	0.904	extracellular exosome
GO:0032991	0.897	protein-containing complex
GO:0031974	0.892	membrane-enclosed lumen
GO:0031090	0.808	organelle membrane
GO:0070013	0.806	intracellular organelle lumen
GO:0042383	0.800	sarcolemma
GO:0042175	0.745	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0031981	0.720	nuclear lumen
GO:0031984	0.700	organelle subcompartment
GO:0005739	0.671	mitochondrion
GO:0005654	0.652	nucleoplasm
GO:0097708	0.643	intracellular vesicle
GO:0031410	0.633	cytoplasmic vesicle
GO:0005789	0.602	endoplasmic reticulum membrane
GO:0098588	0.550	bounding membrane of organelle
GO:0030315	0.516	T-tubule
GO:0030054	0.447	cell junction
GO:0042995	0.371	cell projection
GO:0120025	0.363	plasma membrane bounded cell projection
GO:0045202	0.307	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]