StarFunc result for job id P30740

User Input

>input (379 residues)
MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHF
NTVEEVHSRFQSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVD
FQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEAT
TNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDES
TGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS
KADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEENFTADHPFLF
FIRHNSSGSILFLGRFSSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30740	1.000	1.000	8.326E-85	379	1.000	1.000	P30740.pdb.gz	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
2	AFDB:Q9D154	0.994	0.994	4.911E-75	379	0.805	0.805	Q9D154.pdb.gz	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
3	PDB:4ga7A	0.960	0.986	6.031E-74	369	0.968	0.995	4ga7A.pdb.gz
4	AFDB:Q8VHP7	0.980	0.972	3.055E-71	382	0.765	0.759	Q8VHP7.pdb.gz	ILEUB_MOUSE Leukocyte elastase inhibitor B OS=Mus musculus OX=10090 GN=Serpinb1b PE=1 SV=1
5	AFDB:Q5SV42	0.973	0.984	9.272E-68	375	0.715	0.723	Q5SV42.pdb.gz	ILEUC_MOUSE Leukocyte elastase inhibitor C OS=Mus musculus OX=10090 GN=Serpinb1c PE=1 SV=1
6	AFDB:P35237	0.962	0.970	1.154E-58	376	0.509	0.513	P35237.pdb.gz	SPB6_HUMAN Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3
7	AFDB:Q60854	0.938	0.940	1.606E-57	378	0.499	0.500	Q60854.pdb.gz	SPB6_MOUSE Serpin B6 OS=Mus musculus OX=10090 GN=Serpinb6 PE=1 SV=1
8	AFDB:P50452	0.961	0.973	9.104E-57	374	0.517	0.524	P50452.pdb.gz	SPB8_HUMAN Serpin B8 OS=Homo sapiens OX=9606 GN=SERPINB8 PE=1 SV=2
9	AFDB:P05120	0.951	0.870	2.518E-56	415	0.501	0.458	P05120.pdb.gz	PAI2_HUMAN Plasminogen activator inhibitor 2 OS=Homo sapiens OX=9606 GN=SERPINB2 PE=1 SV=2
10	AFDB:O08804	0.936	0.941	2.838E-56	377	0.485	0.488	O08804.pdb.gz	O08804_MOUSE NK13 OS=Mus musculus OX=10090 GN=Serpinb6b PE=1 SV=2
11	AFDB:Q3TJ69	0.952	0.957	2.170E-55	377	0.480	0.483	Q3TJ69.pdb.gz	Q3TJ69_MOUSE Serpin domain-containing protein OS=Mus musculus OX=10090 GN=Serpinb9b PE=2 SV=1
12	PDB:2h4rA	0.933	0.953	7.859E-50	371	0.456	0.466	2h4rA.pdb.gz
13	PDB:2zv6B	0.930	0.949	9.984E-50	371	0.496	0.507	2zv6B.pdb.gz
14	PDB:2arqA	0.886	0.931	1.711E-49	360	0.470	0.494	2arqA.pdb.gz	Plasminogen activator inhibitor-2 is highly tolerant to P8 residue substitution--implications for serpin mechanistic model and prediction of nsSNP activities
15	PDB:1xqgA	0.935	0.937	4.880E-48	378	0.393	0.394	1xqgA.pdb.gz
16	PDB:2ol2A	0.880	0.925	2.700E-42	360	0.330	0.347	2ol2A.pdb.gz
17	PDB:1jmoA	0.887	0.791	3.138E-41	427	0.340	0.302	1jmoA.pdb.gz
18	PDB:1yxaA	0.884	0.900	8.175E-41	372	0.327	0.333	1yxaA.pdb.gz
19	PDB:4dteA	0.894	0.906	3.649E-40	374	0.298	0.302	4dteA.pdb.gz
20	PDB:3f1sA	0.889	0.876	1.445E-39	385	0.303	0.299	3f1sA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30740	0.0	784	379	1.000	1.000	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
2	Q5SV42	0.0	558	375	0.718	0.725	ILEUC_MOUSE Leukocyte elastase inhibitor C OS=Mus musculus OX=10090 GN=Serpinb1c PE=1 SV=1
3	Q8VHP7	0.0	582	382	0.765	0.759	ILEUB_MOUSE Leukocyte elastase inhibitor B OS=Mus musculus OX=10090 GN=Serpinb1b PE=1 SV=1
4	Q9D154	0.0	626	379	0.805	0.805	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
5	V9HWH1	0.0	784	379	1.000	1.000	V9HWH1_HUMAN Epididymis luminal protein 57 OS=Homo sapiens OX=9606 GN=HEL57 PE=2 SV=1
6	A0A024QZT4	9.26e-136	394	376	0.509	0.513	A0A024QZT4_HUMAN Testicular tissue protein Li 180 OS=Homo sapiens OX=9606 PE=2 SV=1
7	P50453	9.26e-136	394	376	0.509	0.513	SPB9_HUMAN Serpin B9 OS=Homo sapiens OX=9606 GN=SERPINB9 PE=1 SV=1
8	P05120	6.28e-126	370	415	0.501	0.458	PAI2_HUMAN Plasminogen activator inhibitor 2 OS=Homo sapiens OX=9606 GN=SERPINB2 PE=1 SV=2
9	Q80UK5	2.68e-124	365	377	0.475	0.477	Q80UK5_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 9f OS=Mus musculus OX=10090 GN=Serpinb9f PE=2 SV=1
10	P50452	1.59e-122	360	374	0.525	0.532	SPB8_HUMAN Serpin B8 OS=Homo sapiens OX=9606 GN=SERPINB8 PE=1 SV=2
11	O08797	2.99e-120	354	374	0.483	0.489	O08797_MOUSE SPI6 OS=Mus musculus OX=10090 GN=Serpinb9 PE=1 SV=1
12	P35237	7.79e-120	353	376	0.515	0.519	SPB6_HUMAN Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3
13	P48595	8.06e-118	349	397	0.470	0.448	SPB10_HUMAN Serpin B10 OS=Homo sapiens OX=9606 GN=SERPINB10 PE=1 SV=1
14	P29524	1.02e-117	349	416	0.485	0.442	PAI2_RAT Plasminogen activator inhibitor 2 type A OS=Rattus norvegicus OX=10116 GN=Serpinb2 PE=2 SV=1
15	Q6P217	1.27e-115	343	377	0.472	0.475	Q6P217_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 9b OS=Mus musculus OX=10090 GN=Serpinb9b PE=2 SV=1
16	Q9DAV6	1.88e-115	342	377	0.472	0.475	Q9DAV6_MOUSE R86 OS=Mus musculus OX=10090 GN=Serpinb9b PE=1 SV=1
17	Q9UIV8	2.93e-115	342	391	0.475	0.460	SPB13_HUMAN Serpin B13 OS=Homo sapiens OX=9606 GN=SERPINB13 PE=1 SV=2
18	Q8BHL1	3.93e-115	342	387	0.470	0.460	Q8BHL1_MOUSE Squamous cell carcinoma antigen 2 related protein 1 OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
19	Q6UKZ2	6.01e-115	341	387	0.470	0.460	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
20	Q9D1Q5	1.34e-114	340	387	0.467	0.457	Q9D1Q5_MOUSE Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00079 Serpin	3.3e-129	443.0	Serpin (serine protease inhibitor)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370115

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000466090	0.901	Neutrophil elastase
2	9606.ENSP00000234347	0.859	Myeloblastin
3	9606.ENSP00000261921	0.764	Lysyl oxidase homolog 1
4	9606.ENSP00000350937	0.729	Testin
5	9606.ENSP00000216336	0.722	Cathepsin G
6	9606.ENSP00000364520	0.634	Taste receptor type 1 member 2
7	9606.ENSP00000342082	0.607	Antileukoproteinase
8	9606.ENSP00000325548	0.588	Cytosolic non-specific dipeptidase
9	9606.ENSP00000243924	0.582	Elafin
10	9606.ENSP00000345008	0.575	Fibulin-5
11	9606.ENSP00000264870	0.556	Coagulation factor XIII A chain
12	9606.ENSP00000259254	0.542	Glycophorin-C
13	9606.ENSP00000011653	0.540	T-cell surface glycoprotein CD4
14	9606.ENSP00000225275	0.534	Myeloperoxidase
15	9606.ENSP00000351807	0.519	Elastin
16	9606.ENSP00000231449	0.510	Interleukin-4
17	9606.ENSP00000229135	0.507	Interferon gamma
18	9606.ENSP00000373472	0.507	A disintegrin and metalloproteinase with thrombospondin motifs 7
19	9606.ENSP00000230431	0.505	2'-deoxynucleoside 5'-phosphate N-hydrolase 1
20	9606.ENSP00000412237	0.504	Interleukin-10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004867	1.000	serine-type endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0010629	0.989	negative regulation of gene expression
GO:0051239	0.985	regulation of multicellular organismal process
GO:0001817	0.980	regulation of cytokine production
GO:0051246	0.971	regulation of protein metabolic process
GO:0009987	0.969	cellular process
GO:0032652	0.968	regulation of interleukin-1 production
GO:0032692	0.961	negative regulation of interleukin-1 production
GO:0032651	0.958	regulation of interleukin-1 beta production
GO:0045861	0.738	negative regulation of proteolysis
GO:0065009	0.686	regulation of molecular function
GO:0050790	0.670	regulation of catalytic activity
GO:0050794	0.622	regulation of cellular process
GO:0043086	0.576	negative regulation of catalytic activity
GO:0008283	0.545	cell population proliferation
GO:0050896	0.503	response to stimulus
GO:0050673	0.441	epithelial cell proliferation
GO:0048518	0.339	positive regulation of biological process
GO:0048583	0.334	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.997	organelle
GO:0005737	0.997	cytoplasm
GO:0005615	0.997	extracellular space
GO:0071944	0.995	cell periphery
GO:0070013	0.992	intracellular organelle lumen
GO:0012505	0.986	endomembrane system
GO:0043227	0.963	membrane-bounded organelle
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0062023	0.943	collagen-containing extracellular matrix
GO:0030141	0.928	secretory granule
GO:0016020	0.918	membrane
GO:0043230	0.905	extracellular organelle
GO:0070062	0.904	extracellular exosome
GO:0043228	0.848	non-membrane-bounded organelle
GO:0043232	0.830	intracellular non-membrane-bounded organelle
GO:0060205	0.824	cytoplasmic vesicle lumen
GO:0034774	0.804	secretory granule lumen
GO:0005886	0.786	plasma membrane
GO:0005634	0.574	nucleus
GO:0099080	0.514	supramolecular complex
GO:0005829	0.397	cytosol
GO:0035770	0.335	ribonucleoprotein granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]