StarFunc result for job id P30837

User Input

>input (517 residues)
MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPT
TGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNLLADLVERDRVYLA
SLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCG
QIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITG
YGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADM
EHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGP
QVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
VQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHT
PFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CZS1	0.972	0.969	0.000	519	0.938	0.934	Q9CZS1.pdb.gz	AL1B1_MOUSE Aldehyde dehydrogenase X, mitochondrial OS=Mus musculus OX=10090 GN=Aldh1b1 PE=1 SV=1
2	PDB:7mjcA	0.952	0.998	5.078E-101	493	0.950	0.996	7mjcA.pdb.gz	Inhibitors targeted to aldehyde dehydrogenase
3	AFDB:A0A286XPF7	0.967	0.960	2.981E-96	521	0.743	0.737	A0A286XPF7.pdb.gz	A0A286XPF7_CAVPO Aldehyde dehydrogenase 2 family member OS=Cavia porcellus OX=10141 GN=ALDH2 PE=3 SV=1
4	AFDB:A2BGR9	0.972	0.973	1.468E-94	516	0.700	0.702	A2BGR9.pdb.gz
5	PDB:4fr8C	0.954	0.994	2.923E-92	496	0.708	0.738	4fr8C.pdb.gz	Vascular Bioactivation of Nitroglycerin by Aldehyde Dehydrogenase-2: REACTION INTERMEDIATES REVEALED BY CRYSTALLOGRAPHY AND MASS SPECTROMETRY.
6	AFDB:B3DKM0	0.961	0.959	1.985E-90	518	0.665	0.664	B3DKM0.pdb.gz
7	AFDB:Q9VLC5	0.957	0.952	2.358E-90	520	0.652	0.648	Q9VLC5.pdb.gz	Q9VLC5_DROME Aldehyde dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Aldh PE=1 SV=1
8	AFDB:O93344	0.957	0.955	2.333E-89	518	0.638	0.637	O93344.pdb.gz	AL1A2_CHICK Retinal dehydrogenase 2 OS=Gallus gallus OX=9031 GN=ALDH1A2 PE=2 SV=2
9	PDB:6aljA	0.948	0.996	7.012E-88	492	0.638	0.671	6aljA.pdb.gz	Structural Basis of ALDH1A2 Inhibition by Irreversible and Reversible Small Molecule Inhibitors.
10	AFDB:O35945	0.960	0.991	8.537E-87	501	0.629	0.649	O35945.pdb.gz	AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus OX=10090 GN=Aldh1a7 PE=1 SV=1
11	AFDB:Q9DD46	0.956	0.965	8.537E-87	512	0.613	0.619	Q9DD46.pdb.gz	Q9DD46_CHICK Aldehyde dehydrogenase OS=Gallus gallus OX=9031 GN=ALDH6 PE=2 SV=1
12	AFDB:P47895	0.956	0.965	1.603E-86	512	0.617	0.623	P47895.pdb.gz	AL1A3_HUMAN Retinaldehyde dehydrogenase 3 OS=Homo sapiens OX=9606 GN=ALDH1A3 PE=1 SV=2
13	AFDB:P00352	0.959	0.989	3.787E-86	501	0.625	0.645	P00352.pdb.gz	AL1A1_HUMAN Aldehyde dehydrogenase 1A1 OS=Homo sapiens OX=9606 GN=ALDH1A1 PE=1 SV=2
14	PDB:5abmA	0.947	0.991	6.351E-84	494	0.623	0.652	5abmA.pdb.gz	Structural, Biochemical, and Computational Studies Reveal the Mechanism of Selective Aldehyde Dehydrogenase 1A1 Inhibition by Cytotoxic Duocarmycin Analogues.
15	PDB:1zumI	0.900	0.994	1.977E-82	468	0.673	0.744	1zumI.pdb.gz
16	PDB:7yobA	0.950	0.994	2.606E-81	494	0.625	0.654	7yobA.pdb.gz
17	PDB:1o9jA	0.947	0.991	4.121E-81	494	0.594	0.621	1o9jA.pdb.gz	Crystal Structure of Eta-Crystallin: Adaptation of a Class 1 Aldehyde Dehydrogenase for a New Role in the Eye Lens
18	PDB:7a6qA	0.933	0.986	4.319E-80	489	0.609	0.644	7a6qA.pdb.gz	A Selective Competitive Inhibitor of Aldehyde Dehydrogenase 1A3 Hinders Cancer Cell Growth, Invasiveness and Stemness In Vitro.
19	PDB:5fhzF	0.858	0.986	2.275E-68	449	0.561	0.646	5fhzF.pdb.gz	Crystal structure of human aldehyde dehydrogenase 1A3 complexed with NAD(+) and retinoic acid.
20	PDB:7rluA	0.894	0.794	2.832E-67	583	0.456	0.405	7rluA.pdb.gz	Structure of putative tumor suppressor ALDH1L1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A286XPF7	802	521	0.741	0.735	A0A286XPF7_CAVPO Aldehyde dehydrogenase 2 family member OS=Cavia porcellus OX=10141 GN=ALDH2 PE=3 SV=1
2	A0A384MTJ7	1070	517	0.998	0.998	A0A384MTJ7_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
3	C7A2A0	586	534	0.545	0.528	BALDH_ANTMA Benzaldehyde dehydrogenase, mitochondrial OS=Antirrhinum majus OX=4151 GN=BALDH PE=1 SV=1
4	O14293	536	503	0.487	0.501	YF19_SCHPO Putative aldehyde dehydrogenase-like protein C9E9.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9E9.09c PE=1 SV=1
5	O35945	694	501	0.629	0.649	AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus OX=10090 GN=Aldh1a7 PE=1 SV=1
6	O93344	716	518	0.638	0.637	AL1A2_CHICK Retinal dehydrogenase 2 OS=Gallus gallus OX=9031 GN=ALDH1A2 PE=2 SV=2
7	O94788	723	518	0.644	0.643	AL1A2_HUMAN Retinal dehydrogenase 2 OS=Homo sapiens OX=9606 GN=ALDH1A2 PE=1 SV=3
8	P00352	686	501	0.623	0.643	AL1A1_HUMAN Aldehyde dehydrogenase 1A1 OS=Homo sapiens OX=9606 GN=ALDH1A1 PE=1 SV=2
9	P05091	786	517	0.725	0.725	ALDH2_HUMAN Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 PE=1 SV=2
10	P08157	549	497	0.542	0.563	ALDH_EMENI Aldehyde dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aldA PE=3 SV=2
11	P11884	788	519	0.721	0.719	ALDH2_RAT Aldehyde dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aldh2 PE=1 SV=1
12	P13601	684	501	0.615	0.635	AL1A7_RAT Aldehyde dehydrogenase, cytosolic 1 OS=Rattus norvegicus OX=10116 GN=Aldh1a7 PE=1 SV=2
13	P24549	691	501	0.625	0.645	AL1A1_MOUSE Aldehyde dehydrogenase 1A1 OS=Mus musculus OX=10090 GN=Aldh1a1 PE=1 SV=5
14	P30837	1070	517	0.998	0.998	AL1B1_HUMAN Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH1B1 PE=1 SV=4
15	P47738	784	519	0.718	0.715	ALDH2_MOUSE Aldehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh2 PE=1 SV=1
16	P47895	675	512	0.613	0.619	AL1A3_HUMAN Retinaldehyde dehydrogenase 3 OS=Homo sapiens OX=9606 GN=ALDH1A3 PE=1 SV=2
17	P48644	688	501	0.623	0.643	AL1A1_BOVIN Aldehyde dehydrogenase 1A1 OS=Bos taurus OX=9913 GN=ALDH1A1 PE=1 SV=3
18	P51647	695	501	0.631	0.651	AL1A1_RAT Aldehyde dehydrogenase 1A1 OS=Rattus norvegicus OX=10116 GN=Aldh1a1 PE=1 SV=3
19	P51977	691	501	0.625	0.645	AL1A1_SHEEP Aldehyde dehydrogenase 1A1 OS=Ovis aries OX=9940 GN=ALDH1A1 PE=1 SV=2
20	Q28399	655	501	0.594	0.613	ALDH1_ELEED Aldehyde dehydrogenase, cytosolic 1 OS=Elephantulus edwardii OX=28737 GN=ALDH1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00171 Aldedh	1.1e-181	616.0	Aldehyde dehydrogenase family
2	PF18460 HetR_C	5.8e+02	11.9	Heterocyst differentiation regulator C-terminal Hood domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366927

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265395	0.975	3-hydroxyisobutyrate dehydrogenase, mitochondrial
2	9606.ENSP00000379845	0.970	4-aminobutyrate aminotransferase, mitochondrial
3	9606.ENSP00000231420	0.960	Alanine--glyoxylate aminotransferase 2, mitochondrial
4	9606.ENSP00000361140	0.944	Alcohol dehydrogenase [NADP(+)]
5	9606.ENSP00000450436	0.943	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
6	9606.ENSP00000231887	0.927	Peroxisomal bifunctional enzyme
7	9606.ENSP00000340684	0.925	Amine oxidase [flavin-containing] A
8	9606.ENSP00000367309	0.924	Amine oxidase [flavin-containing] B
9	9606.ENSP00000263182	0.922	Gamma-butyrobetaine dioxygenase
10	9606.ENSP00000411613	0.922	Amiloride-sensitive amine oxidase [copper-containing]
11	9606.ENSP00000479130	0.922	Acyl-CoA synthetase family member 3, mitochondrial
12	9606.ENSP00000324343	0.919	Beta-ureidopropionase
13	9606.ENSP00000282538	0.917	Acidic amino acid decarboxylase GADL1
14	9606.ENSP00000416583	0.916	Deoxyribose-phosphate aldolase
15	9606.ENSP00000379895	0.912	Glycine amidinotransferase, mitochondrial
16	9606.ENSP00000351682	0.910	Carnosine dipeptidase 1
17	9606.ENSP00000303246	0.905	Acyl-coenzyme A thioesterase 12
18	9606.ENSP00000325548	0.905	Cytosolic non-specific dipeptidase
19	9606.ENSP00000389009	0.905	Carnosine synthase 1
20	9606.ENSP00000389175	0.905	Glycerate kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004029	0.998	aldehyde dehydrogenase (NAD+) activity
GO:0005488	0.979	binding
GO:0005515	0.913	protein binding
GO:0042802	0.522	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0044281	0.981	small molecule metabolic process
GO:0044238	0.939	primary metabolic process
GO:0065007	0.905	biological regulation
GO:0006807	0.441	nitrogen compound metabolic process
GO:0006082	0.437	organic acid metabolic process
GO:0019752	0.423	carboxylic acid metabolic process
GO:0050896	0.361	response to stimulus
GO:1901564	0.343	organonitrogen compound metabolic process
GO:0009056	0.339	catabolic process
GO:1901575	0.327	organic substance catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0005634	0.991	nucleus
GO:0005739	0.983	mitochondrion
GO:0005829	0.966	cytosol
GO:0031981	0.819	nuclear lumen
GO:0005654	0.777	nucleoplasm
GO:0005759	0.753	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16185	0.998	an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH
EC:1.2.1.3	0.998	aldehyde dehydrogenase (NAD(+)).

[back to server]