StarFunc result for job id P30876

User Input

>input (1174 residues)
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Length	ID1	ID2	Download	Description
1	PDB:3h0gB	0.910	0.928	1150	0.613	0.626	3h0gB.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
2	PDB:3k7aB	0.908	0.950	1122	0.588	0.615	3k7aB.pdb.gz	Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
3	PDB:4aybB	0.882	0.938	1103	0.413	0.440	4aybB.pdb.gz	Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
4	PDB:4bxxB	0.887	0.948	1097	0.576	0.616	4bxxB.pdb.gz	Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
5	PDB:5c4jB	0.934	0.947	1157	0.591	0.600	5c4jB.pdb.gz	Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
6	PDB:5iy6B	0.961	0.968	1165	0.992	1.000	5iy6B.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
7	PDB:5vvrB	0.924	0.900	1207	0.598	0.582	5vvrB.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
8	PDB:6drdB	0.852	0.990	1009	0.859	1.000	6drdB.pdb.gz	Architecture of Pol II(G) and molecular mechanism of transcription regulation by Gdown1.
9	PDB:6o6cB	0.941	0.948	1165	0.591	0.596	6o6cB.pdb.gz	3.1 angstrom structure of yeast RNA polymerase II elongation complex stalled at a cyclobutane pyrimidine dimer lesion solved using streptavidin affinity grids.
10	PDB:7d58B	0.869	0.929	1095	0.368	0.395	7d58B.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
11	AFDB:A5PJW8	0.987	0.987	1174	0.999	0.999	A5PJW8.pdb.gz	A5PJW8_BOVIN DNA-directed RNA polymerase subunit beta OS=Bos taurus OX=9913 GN=POLR2B PE=1 SV=1
12	AFDB:B8YB55	0.912	0.946	1131	0.411	0.427	B8YB55.pdb.gz	RPO2_SACSH DNA-directed RNA polymerase subunit Rpo2 OS=Saccharolobus shibatae OX=2286 GN=rpo2 PE=1 SV=1
13	AFDB:F4KD38	0.900	0.910	1161	0.354	0.358	F4KD38.pdb.gz	NRPC2_ARATH DNA-directed RNA polymerase III subunit 2 OS=Arabidopsis thaliana OX=3702 GN=NRPC2 PE=2 SV=1
14	AFDB:P08266	0.987	0.986	1176	0.857	0.855	P08266.pdb.gz	RPB2_DROME DNA-directed RNA polymerase II subunit RPB2 OS=Drosophila melanogaster OX=7227 GN=RpII140 PE=2 SV=2
15	AFDB:P08518	0.961	0.922	1224	0.600	0.575	P08518.pdb.gz	RPB2_YEAST DNA-directed RNA polymerase II subunit RPB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPB2 PE=1 SV=2
16	AFDB:P11513	0.903	0.940	1126	0.410	0.427	P11513.pdb.gz	RPO2_SULAC DNA-directed RNA polymerase subunit Rpo2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=rpo2 PE=1 SV=2
17	AFDB:P22276	0.888	0.907	1149	0.358	0.366	P22276.pdb.gz	RPC2_YEAST DNA-directed RNA polymerase III subunit RPC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RET1 PE=1 SV=2
18	AFDB:P38420	0.973	0.962	1188	0.670	0.662	P38420.pdb.gz	NRPB2_ARATH DNA-directed RNA polymerase II subunit 2 OS=Arabidopsis thaliana OX=3702 GN=NRPB2 PE=1 SV=2
19	AFDB:Q02061	0.963	0.935	1210	0.624	0.605	Q02061.pdb.gz	RPB2_SCHPO DNA-directed RNA polymerase II subunit RPB2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb2 PE=1 SV=2
20	AFDB:Q10233	0.889	0.896	1165	0.357	0.360	Q10233.pdb.gz	RPC2_SCHPO DNA-directed RNA polymerase III subunit RPC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc2 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A5PJW8	2451	1174	0.999	0.999	A5PJW8_BOVIN DNA-directed RNA polymerase subunit beta OS=Bos taurus OX=9913 GN=POLR2B PE=1 SV=1
2	B8YB55	884	1131	0.417	0.433	RPO2_SACSH DNA-directed RNA polymerase subunit Rpo2 OS=Saccharolobus shibatae OX=2286 GN=rpo2 PE=1 SV=1
3	C9J2Y9	2438	1167	0.994	1.000	C9J2Y9_HUMAN DNA-directed RNA polymerase subunit beta OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=2
4	C9J4M6	2227	1067	0.909	1.000	C9J4M6_HUMAN DNA-directed RNA polymerase subunit beta OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=3
5	F1QQA2	791	1130	0.385	0.400	F1QQA2_DANRE DNA-directed RNA polymerase subunit beta OS=Danio rerio OX=7955 GN=polr3b PE=1 SV=2
6	F4KD38	749	1161	0.360	0.364	NRPC2_ARATH DNA-directed RNA polymerase III subunit 2 OS=Arabidopsis thaliana OX=3702 GN=NRPC2 PE=2 SV=1
7	P08266	2146	1176	0.860	0.859	RPB2_DROME DNA-directed RNA polymerase II subunit RPB2 OS=Drosophila melanogaster OX=7227 GN=RpII140 PE=2 SV=2
8	P08518	1449	1224	0.606	0.581	RPB2_YEAST DNA-directed RNA polymerase II subunit RPB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPB2 PE=1 SV=2
9	P11513	874	1126	0.421	0.439	RPO2_SULAC DNA-directed RNA polymerase subunit Rpo2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=rpo2 PE=1 SV=2
10	P22276	753	1149	0.367	0.375	RPC2_YEAST DNA-directed RNA polymerase III subunit RPC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RET1 PE=1 SV=2
11	P30876	2454	1174	1.000	1.000	RPB2_HUMAN DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1
12	P38420	1608	1188	0.673	0.665	NRPB2_ARATH DNA-directed RNA polymerase II subunit 2 OS=Arabidopsis thaliana OX=3702 GN=NRPB2 PE=1 SV=2
13	Q02061	1523	1210	0.624	0.605	RPB2_SCHPO DNA-directed RNA polymerase II subunit RPB2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb2 PE=1 SV=2
14	Q10233	763	1165	0.365	0.368	RPC2_SCHPO DNA-directed RNA polymerase III subunit RPC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc2 PE=2 SV=1
15	Q4GZE8	674	1129	0.347	0.360	Q4GZE8_TRYB2 DNA-directed RNA polymerase subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.540 PE=3 SV=1
16	Q583H5	1038	1190	0.487	0.481	Q583H5_TRYB2 DNA-directed RNA polymerase subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.30O21.140 PE=3 SV=1
17	Q8CFI7	2452	1174	0.999	0.999	RPB2_MOUSE DNA-directed RNA polymerase II subunit RPB2 OS=Mus musculus OX=10090 GN=Polr2b PE=1 SV=2
18	Q980R1	876	1124	0.414	0.432	RPO2_SACS2 DNA-directed RNA polymerase subunit Rpo2 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=rpo2 PE=1 SV=2
19	Q9LK40	610	1172	0.348	0.348	NRPD2_ARATH DNA-directed RNA polymerases IV and V subunit 2 OS=Arabidopsis thaliana OX=3702 GN=NRPD2 PE=1 SV=1
20	Q9NW08	793	1133	0.382	0.396	RPC2_HUMAN DNA-directed RNA polymerase III subunit RPC2 OS=Homo sapiens OX=9606 GN=POLR3B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04563 RNA_pol_Rpb2_1	9.8e-65	229.4	RNA polymerase beta subunit
2	PF04561 RNA_pol_Rpb2_2	1e-52	190.1	RNA polymerase Rpb2, domain 2
3	PF04565 RNA_pol_Rpb2_3	1.3e-20	84.6	RNA polymerase Rpb2, domain 3
4	PF04566 RNA_pol_Rpb2_4	3.4e-21	86.5	RNA polymerase Rpb2, domain 4
5	PF04567 RNA_pol_Rpb2_5	2.6e-13	61.8	RNA polymerase Rpb2, domain 5
6	PF00562 RNA_pol_Rpb2_6	6.9e-125	428.8	RNA polymerase Rpb2, domain 6
7	PF04560 RNA_pol_Rpb2_7	1.1e-30	117.2	RNA polymerase Rpb2, domain 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008831507.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008820224.1	0.999	DNA-directed RNA polymerase II subunit RPB4
2	1026970.XP_008826292.1	0.999	DNA-directed RNA polymerase II subunit RPB9 isoform X1
3	1026970.XP_008829529.1	0.999	RNA polymerase II subunit H
4	1026970.XP_008829775.1	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC4
5	1026970.XP_008833112.1	0.999	DNA-directed RNA polymerase II subunit RPB3
6	1026970.XP_008835404.1	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC1
7	1026970.XP_008835730.1	0.999	RNA polymerase II subunit G
8	1026970.XP_008849500.1	0.999	RNA polymerase II subunit F
9	1026970.XP_008852647.1	0.999	RNA polymerase II subunit L
10	1026970.XP_008854027.1	0.999	RNA polymerase II subunit A
11	1026970.XP_008830505.1	0.998	RNA polymerase II subunit J
12	1026970.XP_008852185.1	0.992	Transcription elongation factor SPT5 isoform X1
13	1026970.XP_008826512.1	0.989	General transcription factor IIB
14	1026970.XP_008825937.1	0.987	General transcription factor IIF subunit 2
15	1026970.XP_008836748.1	0.987	UBX domain-containing protein 7
16	1026970.XP_008835131.1	0.985	General transcription factor IIF subunit 1 isoform X1
17	1026970.XP_008840915.1	0.984	Transcription elongation factor SPT4 isoform X1
18	1026970.XP_008848911.1	0.978	CTD phosphatase subunit 1
19	1026970.XP_008821917.1	0.974	DNA-directed RNA polymerases I, II, and III subunit RPABC5-like
20	1026970.XP_008826715.1	0.972	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 2 bases at 2 genomic stop codons

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.997	RNA binding
GO:0003677	0.994	DNA binding
GO:0003824	0.912	catalytic activity
GO:0003899	0.830	DNA-directed 5'-3' RNA polymerase activity
GO:0003729	0.355	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0010467	0.993	gene expression
GO:0016070	0.989	RNA metabolic process
GO:0006351	0.899	DNA-templated transcription
GO:0050789	0.685	regulation of biological process
GO:0006366	0.509	transcription by RNA polymerase II
GO:0019222	0.447	regulation of metabolic process
GO:0060255	0.430	regulation of macromolecule metabolic process
GO:0010468	0.406	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.993	protein-containing complex
GO:1902494	0.934	catalytic complex
GO:0140513	0.898	nuclear protein-containing complex
GO:1990234	0.886	transferase complex
GO:0140535	0.873	intracellular protein-containing complex
GO:0055029	0.718	nuclear DNA-directed RNA polymerase complex
GO:0016591	0.714	RNA polymerase II, holoenzyme
GO:0043232	0.688	intracellular non-membrane-bounded organelle
GO:0005737	0.629	cytoplasm
GO:0005665	0.474	RNA polymerase II, core complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.6	0.830	DNA-directed RNA polymerase.

[back to server]