StarFunc result for job id P30939

User Input

>input (366 residues)
MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD
RYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIV
STIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKS
VSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILG
AFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQK
LVRCRC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30939	1.000	1.000	6.802E-44	366	1.000	1.000	P30939.pdb.gz	5HT1F_HUMAN 5-hydroxytryptamine receptor 1F OS=Homo sapiens OX=9606 GN=HTR1F PE=1 SV=1
2	AFDB:P28566	0.790	0.793	4.375E-28	365	0.544	0.545	P28566.pdb.gz	5HT1E_HUMAN 5-hydroxytryptamine receptor 1E OS=Homo sapiens OX=9606 GN=HTR1E PE=1 SV=1
3	PDB:7exdR	0.700	0.931	1.436E-27	272	0.740	0.996	7exdR.pdb.gz	Structural basis for recognition of anti-migraine drug lasmiditan by the serotonin receptor 5-HT 1F -G protein complex.
4	AFDB:P28222	0.775	0.730	5.605E-25	390	0.478	0.449	P28222.pdb.gz	5HT1B_HUMAN 5-hydroxytryptamine receptor 1B OS=Homo sapiens OX=9606 GN=HTR1B PE=1 SV=1
5	AFDB:P28221	0.740	0.719	1.780E-24	377	0.464	0.451	P28221.pdb.gz	5HT1D_HUMAN 5-hydroxytryptamine receptor 1D OS=Homo sapiens OX=9606 GN=HTR1D PE=1 SV=1
6	AFDB:P08908	0.775	0.674	1.438E-23	422	0.404	0.351	P08908.pdb.gz	5HT1A_HUMAN 5-hydroxytryptamine receptor 1A OS=Homo sapiens OX=9606 GN=HTR1A PE=1 SV=3
7	AFDB:P19327	0.780	0.679	1.438E-23	422	0.410	0.355	P19327.pdb.gz	5HT1A_RAT 5-hydroxytryptamine receptor 1A OS=Rattus norvegicus OX=10116 GN=Htr1a PE=1 SV=1
8	AFDB:Q98998	0.803	0.723	1.717E-23	408	0.418	0.375	Q98998.pdb.gz	5HT1A_XENLA 5-hydroxytryptamine receptor 1A OS=Xenopus laevis OX=8355 GN=htr1a PE=2 SV=1
9	AFDB:E9QHE0	0.747	0.663	4.773E-23	413	0.402	0.356	E9QHE0.pdb.gz
10	PDB:7e33R	0.661	0.931	1.210E-21	257	0.467	0.665	7e33R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
11	PDB:7e32R	0.678	0.863	1.805E-21	285	0.451	0.579	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
12	AFDB:A0A060X727	0.742	0.701	7.917E-21	388	0.325	0.307	A0A060X727.pdb.gz	A0A060X727_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00020782001 PE=3 SV=1
13	AFDB:A0A060YPY0	0.770	0.735	9.887E-21	384	0.325	0.310	A0A060YPY0.pdb.gz	A0A060YPY0_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028829001 PE=3 SV=1
14	PDB:6g79S	0.669	0.923	3.103E-20	262	0.429	0.599	6g79S.pdb.gz	Cryo-EM structure of the serotonin 5-HT1Breceptor coupled to heterotrimeric Go.
15	PDB:7e2xR	0.682	0.887	4.308E-18	278	0.372	0.489	7e2xR.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
16	PDB:7xtcR	0.675	0.887	2.459E-16	275	0.309	0.411	7xtcR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
17	PDB:6iblA	0.688	0.636	2.810E-16	397	0.301	0.277	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
18	PDB:7jvqR	0.664	0.837	4.582E-16	286	0.331	0.423	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
19	PDB:7cmuR	0.672	0.893	9.329E-16	272	0.290	0.390	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.
20	PDB:3pblA	0.684	0.583	4.044E-15	432	0.314	0.266	3pblA.pdb.gz	Structure of the human dopamine d3 receptor in complex with a d2/d3 selective antagonist.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30939	0.0	753	366	1.000	1.000	5HT1F_HUMAN 5-hydroxytryptamine receptor 1F OS=Homo sapiens OX=9606 GN=HTR1F PE=1 SV=1
2	P28566	1.09e-134	390	365	0.566	0.567	5HT1E_HUMAN 5-hydroxytryptamine receptor 1E OS=Homo sapiens OX=9606 GN=HTR1E PE=1 SV=1
3	P28222	8.62e-116	343	390	0.489	0.459	5HT1B_HUMAN 5-hydroxytryptamine receptor 1B OS=Homo sapiens OX=9606 GN=HTR1B PE=1 SV=1
4	X5D7I5	8.62e-116	343	390	0.489	0.459	X5D7I5_HUMAN 5-hydroxytryptamine receptor 1B (Fragment) OS=Homo sapiens OX=9606 GN=HTR1B PE=2 SV=1
5	P28334	3.03e-109	326	386	0.448	0.425	5HT1B_MOUSE 5-hydroxytryptamine receptor 1B OS=Mus musculus OX=10090 GN=Htr1b PE=2 SV=1
6	P46636	4.20e-109	326	386	0.451	0.427	5HT1B_CRIGR 5-hydroxytryptamine receptor 1B OS=Cricetulus griseus OX=10029 GN=HTR1B PE=2 SV=1
7	P28564	2.52e-108	324	386	0.445	0.422	5HT1B_RAT 5-hydroxytryptamine receptor 1B OS=Rattus norvegicus OX=10116 GN=Htr1b PE=2 SV=1
8	P28221	3.08e-107	321	377	0.475	0.462	5HT1D_HUMAN 5-hydroxytryptamine receptor 1D OS=Homo sapiens OX=9606 GN=HTR1D PE=1 SV=1
9	P28565	4.13e-99	300	374	0.470	0.460	5HT1D_RAT 5-hydroxytryptamine receptor 1D OS=Rattus norvegicus OX=10116 GN=Htr1d PE=2 SV=1
10	Q61224	9.54e-96	291	374	0.475	0.465	5HT1D_MOUSE 5-hydroxytryptamine receptor 1D OS=Mus musculus OX=10090 GN=Htr1d PE=2 SV=2
11	Q64264	3.14e-90	279	421	0.421	0.366	5HT1A_MOUSE 5-hydroxytryptamine receptor 1A OS=Mus musculus OX=10090 GN=Htr1a PE=2 SV=2
12	P08908	9.62e-89	275	422	0.426	0.370	5HT1A_HUMAN 5-hydroxytryptamine receptor 1A OS=Homo sapiens OX=9606 GN=HTR1A PE=1 SV=3
13	C0ITL9	1.50e-88	274	403	0.423	0.385	C0ITL9_DANRE 5-hydroxytryptamine (serotonin) receptor 1A B OS=Danio rerio OX=7955 GN=htr1ab PE=2 SV=1
14	P19327	1.86e-88	274	422	0.410	0.355	5HT1A_RAT 5-hydroxytryptamine receptor 1A OS=Rattus norvegicus OX=10116 GN=Htr1a PE=1 SV=1
15	Q98998	4.27e-85	265	408	0.404	0.363	5HT1A_XENLA 5-hydroxytryptamine receptor 1A OS=Xenopus laevis OX=8355 GN=htr1a PE=2 SV=1
16	P20905	5.41e-74	241	564	0.385	0.250	5HT1R_DROME 5-hydroxytryptamine receptor 1 OS=Drosophila melanogaster OX=7227 GN=5-HT7 PE=2 SV=1
17	A0A060YLN9	1.64e-71	229	380	0.358	0.345	A0A060YLN9_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00008424001 PE=3 SV=1
18	Q90WY6	2.74e-69	225	432	0.363	0.308	ADA2C_DANRE Alpha-2C adrenergic receptor OS=Danio rerio OX=7955 GN=adra2c PE=3 SV=1
19	A0A060W6G8	1.11e-68	223	390	0.355	0.333	A0A060W6G8_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00082532001 PE=3 SV=1
20	A0A060W139	1.87e-68	222	390	0.355	0.333	A0A060W139_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077426001 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	3.3e-73	257.8	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	80	14.5	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	1.9e-05	35.7	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF10323 7TM_GPCR_Srv	0.0017	29.4	Serpentine type 7TM GPCR chemoreceptor Srv
5	PF10328 7TM_GPCR_Srx	0.65	21.1	Serpentine type 7TM GPCR chemoreceptor Srx
6	PF00802 Glycoprotein_G	6.4e+02	11.1	Pneumovirus attachment glycoprotein G

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322924

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334448	0.661	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
2	9606.ENSP00000384364	0.661	Pro-neuropeptide Y
3	9606.ENSP00000261837	0.656	Guanine nucleotide-binding protein subunit beta-5
4	9606.ENSP00000229264	0.648	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
5	9606.ENSP00000232564	0.648	Guanine nucleotide-binding protein subunit beta-4
6	9606.ENSP00000305260	0.648	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
7	9606.ENSP00000481878	0.648	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
8	9606.ENSP00000312999	0.645	Guanine nucleotide-binding protein G(i) subunit alpha-2
9	9606.ENSP00000343027	0.645	Guanine nucleotide-binding protein G(i) subunit alpha-1
10	9606.ENSP00000358867	0.645	Guanine nucleotide-binding protein G(k) subunit alpha
11	9606.ENSP00000287641	0.644	Somatostatin
12	9606.ENSP00000260191	0.634	5-hydroxytryptamine receptor 3B
13	9606.ENSP00000371594	0.631	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
14	9606.ENSP00000347754	0.630	5-hydroxytryptamine receptor 3A
15	9606.ENSP00000217386	0.616	Oxytocin-neurophysin 1
16	9606.ENSP00000248150	0.608	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
17	9606.ENSP00000294117	0.608	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
18	9606.ENSP00000375727	0.608	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4
19	9606.ENSP00000335074	0.606	Appetite-regulating hormone
20	9606.ENSP00000300873	0.602	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004993	1.000	G protein-coupled serotonin receptor activity
GO:0097159	0.998	organic cyclic compound binding
GO:0043169	0.998	cation binding
GO:1901363	0.995	heterocyclic compound binding
GO:0043176	0.994	amine binding
GO:0005515	0.972	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.998	signal transduction
GO:0007186	0.990	G protein-coupled receptor signaling pathway
GO:0007187	0.966	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007193	0.955	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007268	0.865	chemical synaptic transmission

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.761	organelle
GO:0005622	0.723	intracellular anatomical structure
GO:0005737	0.709	cytoplasm
GO:0043227	0.477	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]