StarFunc result for job id P30990

User Input

>input (170 residues)
MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLN
VCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWE
LIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P30990	1.000	1.000	9.158E-28	170	1.000	1.000	P30990.pdb.gz	NEUT_HUMAN Neurotensin/neuromedin N OS=Homo sapiens OX=9606 GN=NTS PE=1 SV=2
2	AFDB:Q9D3P9	0.781	0.785	2.903E-21	169	0.812	0.817	Q9D3P9.pdb.gz	NEUT_MOUSE Neurotensin/neuromedin N OS=Mus musculus OX=10090 GN=Nts PE=2 SV=1
3	AFDB:P20068	0.598	0.601	1.778E-16	169	0.776	0.781	P20068.pdb.gz	NEUT_RAT Neurotensin/neuromedin N OS=Rattus norvegicus OX=10116 GN=Nts PE=1 SV=1
4	AFDB:E9QGL9	0.202	0.035	3.607E-1	1313	0.129	0.017	E9QGL9.pdb.gz
5	PDB:2j6aA	0.115	0.140	7.821E-1	136	0.053	0.066	2j6aA.pdb.gz	The Zinc Finger Protein Ynr046W is Plurifunctional and a Component of the Erf1 Methyltransferase in Yeast.
6	AFDB:A0A1B0GVV3	0.252	0.118	1.314	386	0.118	0.052	A0A1B0GVV3.pdb.gz	A0A1B0GVV3_HUMAN Rab interacting lysosomal protein like 1 OS=Homo sapiens OX=9606 GN=RILPL1 PE=1 SV=1
7	AFDB:Q6NRK1	0.149	0.070	1.611	554	0.118	0.036	Q6NRK1.pdb.gz	ADIPA_XENLA Afadin- and alpha-actinin-binding protein A OS=Xenopus laevis OX=8355 GN=ssx2ip-a PE=1 SV=1
8	AFDB:Q96NJ3	0.173	0.068	1.611	590	0.106	0.031	Q96NJ3.pdb.gz	ZN285_HUMAN Zinc finger protein 285 OS=Homo sapiens OX=9606 GN=ZNF285 PE=1 SV=3
9	AFDB:Q7L0Y3	0.186	0.093	1.976	403	0.082	0.035	Q7L0Y3.pdb.gz	TM10C_HUMAN tRNA methyltransferase 10 homolog C OS=Homo sapiens OX=9606 GN=TRMT10C PE=1 SV=2
10	AFDB:Q38BU4	0.202	0.041	2.424	1223	0.176	0.025	Q38BU4.pdb.gz	Q38BU4_TRYB2 Bilobe protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4540 PE=4 SV=1
11	AFDB:Q9GQF1	0.209	0.035	2.424	1227	0.153	0.021	Q9GQF1.pdb.gz	JIP3_DROME JNK-interacting protein 3 OS=Drosophila melanogaster OX=7227 GN=syd PE=1 SV=1
12	PDB:7suk6	0.256	0.171	3.740	277	0.176	0.108	7suk6.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
13	PDB:6lo8E	0.138	0.247	4.004	80	0.053	0.113	6lo8E.pdb.gz
14	PDB:7ajuUK	0.162	0.136	4.286	219	0.106	0.082	7ajuUK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:6k15J	0.130	0.100	4.911	235	0.100	0.072	6k15J.pdb.gz	Structure of the RSC complex bound to the nucleosome.
16	PDB:7v2wI	0.117	0.105	5.256	240	0.100	0.071	7v2wI.pdb.gz
17	PDB:5xtcU	0.115	0.177	7.386	83	0.082	0.169	5xtcU.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
18	PDB:6f1eA	0.160	0.183	7.386	143	0.100	0.119	6f1eA.pdb.gz
19	PDB:7vciH	0.160	0.039	7.386	798	0.059	0.013	7vciH.pdb.gz
20	PDB:5gm6K	0.159	0.295	7.906	84	0.071	0.143	5gm6K.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30990	4.51e-127	355	170	1.000	1.000	NEUT_HUMAN Neurotensin/neuromedin N OS=Homo sapiens OX=9606 GN=NTS PE=1 SV=2
2	Q6FH20	4.51e-127	355	170	1.000	1.000	Q6FH20_HUMAN Neurotensin/neuromedin N OS=Homo sapiens OX=9606 GN=NTS PE=2 SV=1
3	Q9D3P9	6.85e-104	296	169	0.812	0.817	NEUT_MOUSE Neurotensin/neuromedin N OS=Mus musculus OX=10090 GN=Nts PE=2 SV=1
4	P20068	4.79e-99	284	169	0.776	0.781	NEUT_RAT Neurotensin/neuromedin N OS=Rattus norvegicus OX=10116 GN=Nts PE=1 SV=1
5	Q501D5	0.61	32.7	589	0.141	0.041	MCMBP_ARATH Mini-chromosome maintenance complex-binding protein OS=Arabidopsis thaliana OX=3702 GN=ETG1 PE=1 SV=1
6	C8V449	1.5	31.6	564	0.194	0.059	C8V449_EMENI Phosphoribosylaminoimidazole carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03626 PE=3 SV=1
7	Q551Q8	1.5	31.6	843	0.100	0.020	Q551Q8_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276395 PE=4 SV=1
8	Q381P2	5.9	29.6	974	0.094	0.016	Q381P2_TRYB2 U5 small nuclear ribonucleoprotein component, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7080 PE=4 SV=1
9	F4JD14	8.1	29.3	1941	0.065	0.006	BCHC1_ARATH BEACH domain-containing protein C1 OS=Arabidopsis thaliana OX=3702 GN=BCHC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07421 Pro-NT_NN	2.3e-74	260.3	Neurotensin/neuromedin N precursor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256010

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256637	0.999	Sortilin
2	9606.ENSP00000359532	0.999	Neurotensin receptor type 1
3	9606.ENSP00000303686	0.998	Neurotensin receptor type 2
4	9606.ENSP00000370372	0.994	Neurolysin, mitochondrial
5	9606.ENSP00000384421	0.939	Tuftelin-interacting protein 11
6	9606.ENSP00000256857	0.928	Gastrin-releasing peptide
7	9606.ENSP00000379472	0.917	Cholecystokinin
8	9606.ENSP00000321106	0.911	Protachykinin-1
9	9606.ENSP00000303452	0.903	Pro-thyrotropin-releasing hormone
10	9606.ENSP00000287641	0.876	Somatostatin
11	9606.ENSP00000388825	0.875	Promotilin
12	9606.ENSP00000331358	0.857	Gastrin
13	9606.ENSP00000356213	0.832	VIP peptides
14	9606.ENSP00000265643	0.827	Galanin peptides
15	9606.ENSP00000172229	0.818	Tumor necrosis factor receptor superfamily member 16
16	9606.ENSP00000265023	0.815	Kininogen-1
17	9606.ENSP00000335074	0.809	Appetite-regulating hormone
18	9606.ENSP00000384364	0.809	Pro-neuropeptide Y
19	9606.ENSP00000379138	0.796	Alpha-fetoprotein
20	9606.ENSP00000440185	0.796	Proenkephalin-B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	1.000	receptor ligand activity
GO:0071855	0.996	neuropeptide receptor binding
GO:0005179	0.597	hormone activity
GO:0005184	0.517	neuropeptide hormone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0009987	0.988	cellular process
GO:0050794	0.980	regulation of cellular process
GO:0051716	0.973	cellular response to stimulus
GO:0007165	0.939	signal transduction
GO:0007186	0.891	G protein-coupled receptor signaling pathway
GO:0048518	0.888	positive regulation of biological process
GO:0048519	0.874	negative regulation of biological process
GO:0019222	0.867	regulation of metabolic process
GO:0048522	0.848	positive regulation of cellular process
GO:0060255	0.827	regulation of macromolecule metabolic process
GO:0006950	0.817	response to stress
GO:0006952	0.765	defense response
GO:0006959	0.732	humoral immune response
GO:0065009	0.713	regulation of molecular function
GO:0048583	0.706	regulation of response to stimulus
GO:0009605	0.692	response to external stimulus
GO:0009893	0.681	positive regulation of metabolic process
GO:0080090	0.674	regulation of primary metabolic process
GO:0023051	0.656	regulation of signaling
GO:0010646	0.655	regulation of cell communication
GO:0019730	0.654	antimicrobial humoral response
GO:0051171	0.648	regulation of nitrogen compound metabolic process
GO:0032501	0.597	multicellular organismal process
GO:0009966	0.584	regulation of signal transduction
GO:0010468	0.574	regulation of gene expression
GO:0010604	0.572	positive regulation of macromolecule metabolic process
GO:0031323	0.560	regulation of cellular metabolic process
GO:0061844	0.552	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0044093	0.372	positive regulation of molecular function
GO:0010647	0.344	positive regulation of cell communication
GO:0048584	0.340	positive regulation of response to stimulus
GO:0048523	0.337	negative regulation of cellular process
GO:0023056	0.325	positive regulation of signaling
GO:0009892	0.309	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005576	0.976	extracellular region
GO:0005737	0.710	cytoplasm
GO:0070013	0.332	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]