StarFunc result for job id P31040

User Input

>input (664 residues)
MSGVRGLSRLLSARRLALAKAWPTVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDK
VPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKIS
KLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
IDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRPVIDKTLNEADCATVPPA
IRSY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1yq3A	0.923	0.999	0.000	614	0.849	0.919	1yq3A.pdb.gz	3-Nitropropionic Acid Is a Suicide Inhibitor of Mitochondrial Respiration That, upon Oxidation by Complex II, Forms a Covalent Adduct with a Catalytic Base Arginine in the Active Site of the Enzyme
2	AFDB:D6RFM5	0.806	0.917	0.000	583	0.878	1.000	D6RFM5.pdb.gz	D6RFM5_HUMAN Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=1
3	AFDB:P31039	0.951	0.949	0.000	665	0.934	0.932	P31039.pdb.gz	SDHA_BOVIN Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Bos taurus OX=9913 GN=SDHA PE=1 SV=3
4	AFDB:Q09508	0.940	0.966	0.000	646	0.688	0.707	Q09508.pdb.gz	SDHA_CAEEL Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=sdha-1 PE=2 SV=3
5	AFDB:Q94523	0.924	0.928	0.000	661	0.739	0.743	Q94523.pdb.gz	SDHA_DROME Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Drosophila melanogaster OX=7227 GN=SdhA PE=2 SV=3
6	AFDB:Q9YHT1	0.961	0.960	0.000	665	0.890	0.889	Q9YHT1.pdb.gz	SDHA_CHICK Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Gallus gallus OX=9031 GN=SDHA PE=1 SV=2
7	AFDB:Q9UTJ7	0.899	0.931	3.609E-101	641	0.654	0.677	Q9UTJ7.pdb.gz	SDHA_SCHPO Probable succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sdh1 PE=2 SV=1
8	AFDB:Q9U3X4	0.892	0.946	8.213E-101	626	0.636	0.674	Q9U3X4.pdb.gz	SDHA_DICDI Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=sdhA PE=3 SV=1
9	AFDB:Q00711	0.915	0.949	1.205E-100	640	0.627	0.650	Q00711.pdb.gz	SDHA_YEAST Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SDH1 PE=1 SV=1
10	AFDB:O82663	0.885	0.927	1.769E-100	634	0.649	0.680	O82663.pdb.gz	SDHA1_ARATH Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH1-1 PE=1 SV=1
11	AFDB:Q6ZDY8	0.901	0.949	2.327E-100	630	0.648	0.683	Q6ZDY8.pdb.gz	SDHA_ORYSJ Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=SDH1 PE=1 SV=1
12	PDB:2aczA	0.842	0.949	4.658E-65	588	0.450	0.509	2aczA.pdb.gz	Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
13	PDB:5vpnE	0.797	0.902	6.115E-57	585	0.351	0.398	5vpnE.pdb.gz	Structural and biochemical analyses reveal insights into covalent flavinylation of the Escherichia coli Complex II homolog quinol:fumarate reductase.
14	PDB:6b58C	0.736	0.893	6.109E-53	544	0.333	0.406	6b58C.pdb.gz	Crystal structure of an assembly intermediate of respiratory Complex II.
15	PDB:3cirA	0.756	0.922	1.639E-52	541	0.336	0.412	3cirA.pdb.gz	A threonine on the active site loop controls transition state formation in Escherichia coli respiratory complex II.
16	PDB:7jz2A	0.692	0.949	6.814E-51	481	0.366	0.505	7jz2A.pdb.gz	A 'Build and Retrieve' methodology to simultaneously solve cryo-EM structures of membrane proteins.
17	PDB:6awfE	0.694	0.941	2.402E-47	487	0.292	0.398	6awfE.pdb.gz	New crystal forms of the integral membrane Escherichia coli quinol:fumarate reductase suggest that ligands control domain movement.
18	PDB:3cirM	0.699	0.914	8.466E-42	504	0.294	0.387	3cirM.pdb.gz	A threonine on the active site loop controls transition state formation in Escherichia coli respiratory complex II.
19	PDB:1knpA	0.676	0.845	2.675E-38	529	0.235	0.295	1knpA.pdb.gz	Structure of FAD-bound L-aspartate oxidase: insight into substrate specificity and catalysis.
20	PDB:1chuA	0.561	0.761	1.460E-29	478	0.217	0.301	1chuA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6RFM5	0.0	1074	583	0.779	0.887	D6RFM5_HUMAN Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=1
2	O82663	0.0	834	634	0.636	0.666	SDHA1_ARATH Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH1-1 PE=1 SV=1
3	P0AC41	0.0	543	588	0.456	0.515	SDHA_ECOLI Succinate dehydrogenase flavoprotein subunit OS=Escherichia coli (strain K12) OX=83333 GN=sdhA PE=1 SV=1
4	P31039	0.0	1262	665	0.935	0.934	SDHA_BOVIN Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Bos taurus OX=9913 GN=SDHA PE=1 SV=3
5	P31040	0.0	1383	664	1.000	1.000	SDHA_HUMAN Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=2
6	P47052	0.0	830	634	0.613	0.642	SDHX_YEAST Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YJL045W PE=3 SV=1
7	Q00711	0.0	848	640	0.636	0.659	SDHA_YEAST Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SDH1 PE=1 SV=1
8	Q09508	0.0	928	646	0.685	0.704	SDHA_CAEEL Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=sdha-1 PE=2 SV=3
9	Q0QF01	0.0	1262	664	0.946	0.946	SDHA_PIG Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Sus scrofa OX=9823 GN=SDHA PE=1 SV=2
10	Q57TV5	0.0	759	609	0.556	0.606	Q57TV5_TRYB2 Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.380 PE=3 SV=1
11	Q6ZDY8	0.0	844	630	0.637	0.671	SDHA_ORYSJ Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=SDH1 PE=1 SV=1
12	Q8K2B3	0.0	1265	664	0.949	0.949	SDHA_MOUSE Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1
13	Q920L2	0.0	1249	656	0.916	0.927	SDHA_RAT Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sdha PE=1 SV=1
14	Q94523	0.0	999	661	0.741	0.744	SDHA_DROME Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Drosophila melanogaster OX=7227 GN=SdhA PE=2 SV=3
15	Q9U3X4	0.0	850	626	0.630	0.668	SDHA_DICDI Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=sdhA PE=3 SV=1
16	Q9UTJ7	0.0	891	641	0.642	0.665	SDHA_SCHPO Probable succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sdh1 PE=2 SV=1
17	Q9YHT1	0.0	1217	665	0.890	0.889	SDHA_CHICK Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Gallus gallus OX=9031 GN=SDHA PE=1 SV=2
18	Q9ZPX5	0.0	827	632	0.633	0.665	SDHA2_ARATH Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SDH1-2 PE=1 SV=1
19	O53370	3.47e-174	511	590	0.434	0.488	O53370_MYCTU Succinate dehydrogenase flavoprotein subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=sdhA PE=1 SV=1
20	P00363	6.63e-118	367	602	0.340	0.375	FRDA_ECOLI Fumarate reductase flavoprotein subunit OS=Escherichia coli (strain K12) OX=83333 GN=frdA PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01266 DAO	20	16.2	FAD dependent oxidoreductase
2	PF00890 FAD_binding_2	3.9e-124	426.6	FAD binding domain
3	PF01494 FAD_binding_3	14	16.4	FAD binding domain
4	PF01134 GIDA	0.77	20.4	Glucose inhibited division protein A
5	PF03486 HI0933_like	4.6e+02	10.9	HI0933-like protein
6	PF07992 Pyr_redox_2	0.03	25.2	Pyridine nucleotide-disulphide oxidoreductase
7	PF02910 Succ_DH_flav_C	3.8e-37	138.5	Fumarate reductase flavoprotein C-term
8	PF01946 Thi4	0.12	23.2	Thi4 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264932

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356953	0.999	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
2	9606.ENSP00000364649	0.999	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
3	9606.ENSP00000364699	0.999	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
4	9606.ENSP00000301761	0.996	Succinate dehydrogenase assembly factor 2, mitochondrial
5	9606.ENSP00000377446	0.996	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
6	9606.ENSP00000367923	0.995	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
7	9606.ENSP00000355518	0.993	Fumarate hydratase, mitochondrial
8	9606.ENSP00000322450	0.989	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
9	9606.ENSP00000306397	0.987	Cytochrome b-c1 complex subunit Rieske, mitochondrial
10	9606.ENSP00000392709	0.986	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
11	9606.ENSP00000419325	0.985	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
12	9606.ENSP00000356972	0.984	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
13	9606.ENSP00000359505	0.983	Succinate dehydrogenase assembly factor 4, mitochondrial
14	9606.ENSP00000268379	0.978	Cytochrome b-c1 complex subunit 2, mitochondrial
15	9606.ENSP00000203407	0.977	Cytochrome b-c1 complex subunit 1, mitochondrial
16	9606.ENSP00000317159	0.972	Cytochrome c1, heme protein, mitochondrial
17	9606.ENSP00000262030	0.966	ATP synthase subunit beta, mitochondrial
18	9606.ENSP00000266544	0.965	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
19	9606.ENSP00000263774	0.962	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
20	9606.ENSP00000216254	0.961	Aconitate hydratase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016635	0.998	oxidoreductase activity, acting on the CH-CH group of donors, quinone or related compound as acceptor
GO:0000104	0.998	succinate dehydrogenase activity
GO:0005515	0.994	protein binding
GO:0008177	0.989	succinate dehydrogenase (ubiquinone) activity
GO:1901363	0.803	heterocyclic compound binding
GO:0097159	0.803	organic cyclic compound binding
GO:0036094	0.633	small molecule binding
GO:0000166	0.606	nucleotide binding
GO:0050660	0.423	flavin adenine dinucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.999	cellular metabolic process
GO:0022900	0.980	electron transport chain
GO:0022904	0.965	respiratory electron transport chain
GO:0009060	0.916	aerobic respiration
GO:0044238	0.869	primary metabolic process
GO:0071704	0.766	organic substance metabolic process
GO:0044281	0.400	small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.999	membrane
GO:0032991	0.985	protein-containing complex
GO:0031090	0.979	organelle membrane
GO:0070013	0.976	intracellular organelle lumen
GO:0098798	0.969	mitochondrial protein-containing complex
GO:0098803	0.967	respiratory chain complex
GO:0005740	0.965	mitochondrial envelope
GO:0019866	0.955	organelle inner membrane
GO:0005743	0.949	mitochondrial inner membrane
GO:0045273	0.946	respiratory chain complex II
GO:0005634	0.937	nucleus
GO:1990204	0.930	oxidoreductase complex
GO:0031981	0.885	nuclear lumen
GO:0098800	0.849	inner mitochondrial membrane protein complex
GO:0045257	0.787	succinate dehydrogenase complex (ubiquinone)
GO:0043232	0.745	intracellular non-membrane-bounded organelle
GO:0045283	0.700	fumarate reductase complex
GO:0005746	0.446	mitochondrial respirasome
GO:0005749	0.332	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)
GO:0005654	0.313	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16357	0.998	A + succinate = AH2 + fumarate
EC:1.3.5.-	0.998	With a quinone or related compound as acceptor.
RHEA:13713	0.989	a ubiquinone + succinate = a ubiquinol + fumarate
EC:1.3.5.1	0.989	succinate dehydrogenase.

[back to server]