StarFunc result for job id P31146

User Input

>input (461 residues)
MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFL
VLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPL
REPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIY
SVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFS
RMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSE
APFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQ
EDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPE
ASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G8G223	0.903	0.903	2.495E-87	461	0.941	0.941	G8G223.pdb.gz	G8G223_PIG Coronin OS=Sus scrofa OX=9823 GN=coro1a PE=3 SV=1
2	AFDB:B0R0D7	0.886	0.862	3.178E-76	474	0.670	0.652	B0R0D7.pdb.gz	COR1C_DANRE Coronin-1C-A OS=Danio rerio OX=7955 GN=coro1ca PE=2 SV=1
3	AFDB:Q9BR76	0.853	0.804	1.477E-75	489	0.681	0.642	Q9BR76.pdb.gz	COR1B_HUMAN Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1
4	AFDB:Q7SX58	0.857	0.868	4.190E-75	455	0.681	0.690	Q7SX58.pdb.gz	Q7SX58_DANRE Coronin OS=Danio rerio OX=7955 GN=fj83g12 PE=1 SV=1
5	AFDB:Q6QEF8	0.885	0.865	1.008E-74	472	0.677	0.661	Q6QEF8.pdb.gz	CORO6_HUMAN Coronin-6 OS=Homo sapiens OX=9606 GN=CORO6 PE=1 SV=2
6	AFDB:Q9ULV4	0.877	0.853	2.178E-73	474	0.655	0.637	Q9ULV4.pdb.gz	COR1C_HUMAN Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1
7	PDB:7styA	0.834	0.985	1.565E-69	390	0.616	0.728	7styA.pdb.gz
8	AFDB:A0A0B4KEJ7	0.870	0.751	1.215E-63	535	0.527	0.454	A0A0B4KEJ7.pdb.gz	A0A0B4KEJ7_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
9	AFDB:P27133	0.834	0.863	1.710E-57	445	0.388	0.402	P27133.pdb.gz	COROA_DICDI Coronin-A OS=Dictyostelium discoideum OX=44689 GN=corA PE=1 SV=2
10	AFDB:Q8BH44	0.852	0.819	2.802E-57	480	0.440	0.423	Q8BH44.pdb.gz	COR2B_MOUSE Coronin-2B OS=Mus musculus OX=10090 GN=Coro2b PE=1 SV=2
11	AFDB:Q8C0P5	0.827	0.730	3.903E-56	524	0.447	0.393	Q8C0P5.pdb.gz	COR2A_MOUSE Coronin-2A OS=Mus musculus OX=10090 GN=Coro2a PE=2 SV=1
12	PDB:2h9lA	0.529	0.732	6.172E-15	321	0.132	0.190	2h9lA.pdb.gz
13	PDB:3w15A	0.512	0.679	1.192E-14	336	0.115	0.158	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
14	PDB:5nnzA	0.480	0.638	3.382E-14	335	0.132	0.182	5nnzA.pdb.gz
15	PDB:5mzhB	0.495	0.544	4.450E-14	415	0.113	0.125	5mzhB.pdb.gz
16	PDB:7mq8LU	0.538	0.555	4.450E-14	445	0.108	0.112	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:3jcmB	0.545	0.582	1.013E-13	429	0.124	0.133	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
18	PDB:5jpqY	0.522	0.644	2.185E-13	365	0.100	0.126	5jpqY.pdb.gz	Architecture of the 90S Pre-ribosome: A Structural View on the Birth of the Eukaryotic Ribosome.
19	PDB:6bk8D	0.522	0.654	2.185E-13	359	0.134	0.173	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
20	PDB:7bt6x	0.496	0.471	2.308E-13	488	0.130	0.123	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0R0D7	0.0	676	474	0.675	0.656	COR1C_DANRE Coronin-1C-A OS=Danio rerio OX=7955 GN=coro1ca PE=2 SV=1
2	G8G223	0.0	898	461	0.941	0.941	G8G223_PIG Coronin OS=Sus scrofa OX=9823 GN=coro1a PE=3 SV=1
3	O89046	0.0	659	484	0.666	0.634	COR1B_RAT Coronin-1B OS=Rattus norvegicus OX=10116 GN=Coro1b PE=1 SV=1
4	O89053	0.0	910	461	0.946	0.946	COR1A_MOUSE Coronin-1A OS=Mus musculus OX=10090 GN=Coro1a PE=1 SV=5
5	P31146	0.0	951	461	1.000	1.000	COR1A_HUMAN Coronin-1A OS=Homo sapiens OX=9606 GN=CORO1A PE=1 SV=4
6	Q6QEF8	0.0	662	472	0.685	0.669	CORO6_HUMAN Coronin-6 OS=Homo sapiens OX=9606 GN=CORO6 PE=1 SV=2
7	Q7SX58	0.0	680	455	0.679	0.688	Q7SX58_DANRE Coronin OS=Danio rerio OX=7955 GN=fj83g12 PE=1 SV=1
8	Q9BR76	0.0	661	489	0.677	0.638	COR1B_HUMAN Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1
9	Q9ULV4	0.0	660	474	0.659	0.641	COR1C_HUMAN Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1
10	Q9WUM3	0.0	664	484	0.670	0.638	COR1B_MOUSE Coronin-1B OS=Mus musculus OX=10090 GN=Coro1b PE=1 SV=1
11	Q9WUM4	0.0	663	474	0.662	0.643	COR1C_MOUSE Coronin-1C OS=Mus musculus OX=10090 GN=Coro1c PE=1 SV=2
12	Q7JVY0	6.91e-175	503	528	0.536	0.468	Q7JVY0_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
13	A0A0B4KEJ7	2.40e-173	499	535	0.538	0.464	A0A0B4KEJ7_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
14	A0A0B4KEU5	3.99e-172	496	534	0.536	0.463	A0A0B4KEU5_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
15	Q9UQ03	3.92e-141	415	480	0.449	0.431	COR2B_HUMAN Coronin-2B OS=Homo sapiens OX=9606 GN=CORO2B PE=1 SV=4
16	Q8BH44	8.96e-141	414	480	0.447	0.429	COR2B_MOUSE Coronin-2B OS=Mus musculus OX=10090 GN=Coro2b PE=1 SV=2
17	Q8C0P5	3.94e-138	409	524	0.447	0.393	COR2A_MOUSE Coronin-2A OS=Mus musculus OX=10090 GN=Coro2a PE=2 SV=1
18	Q92828	9.76e-137	405	525	0.414	0.364	COR2A_HUMAN Coronin-2A OS=Homo sapiens OX=9606 GN=CORO2A PE=1 SV=2
19	P27133	3.67e-125	373	445	0.367	0.380	COROA_DICDI Coronin-A OS=Dictyostelium discoideum OX=44689 GN=corA PE=1 SV=2
20	O13923	3.69e-112	345	601	0.371	0.285	CORO_SCHPO Coronin-like protein crn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=crn1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12443 AKNA	2.6e+02	13.7	AT-hook-containing transcription factor
2	PF12894 ANAPC4_WD40	0.025	26.2	Anaphase-promoting complex subunit 4 WD40 domain
3	PF13094 CENP-Q	31	16.1	CENP-Q, a CENPA-CAD centromere complex subunit
4	PF16526 CLZ	1.2e+02	14.5	C-terminal leucine zipper domain of cyclic nucleotide-gated channels
5	PF04977 DivIC	3e+02	12.6	Septum formation initiator
6	PF07323 DUF1465	1.4e+02	13.8	Protein of unknown function (DUF1465)
7	PF08953 DUF1899	1.7e-27	106.4	Domain of unknown function (DUF1899)
8	PF10805 DUF2730	4.5e+02	12.4	Protein of unknown function (DUF2730)
9	PF16888 DUF5082	6.1e+02	12.1	Domain of unknown function (DUF5082)
10	PF05377 FlaC_arch	1.9e+02	13.9	Flagella accessory protein C (FlaC)
11	PF20426 NBCH_WD40	1.1	19.6	Neurobeachin beta propeller domain
12	PF08954 Trimer_CC	3e-32	121.3	Trimerisation motif
13	PF08700 Vps51	1.3e+02	14.0	Vps51/Vps67
14	PF00400 WD40	2e-14	64.9	WD domain, G-beta repeat
15	PF16300 WD40_4	9.4e-19	78.3	Type of WD40 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219150

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365891	0.889	Wiskott-Aldrich syndrome protein
2	9606.ENSP00000389631	0.882	Actin-related protein 2/3 complex subunit 1B
3	9606.ENSP00000367220	0.878	Actin-related protein 2
4	9606.ENSP00000294507	0.863	Lysosomal-associated transmembrane protein 5
5	9606.ENSP00000377471	0.856	Coronin-1B
6	9606.ENSP00000269321	0.824	Rho GDP-dissociation inhibitor 1
7	9606.ENSP00000263238	0.803	Actin-related protein 3
8	9606.ENSP00000312778	0.784	Intraflagellar transport protein 80 homolog
9	9606.ENSP00000432660	0.781	Cofilin-1
10	9606.ENSP00000380948	0.764	Integrin beta-2
11	9606.ENSP00000381581	0.757	Plastin-2
12	9606.ENSP00000356992	0.744	Rho GTPase-activating protein 30
13	9606.ENSP00000464443	0.738	Intraflagellar transport protein 20 homolog
14	9606.ENSP00000311447	0.737	Aspartate beta-hydroxylase domain containing 1
15	9606.ENSP00000359045	0.737	Rho GTPase-activating protein 4
16	9606.ENSP00000249071	0.731	Ras-related C3 botulinum toxin substrate 2
17	9606.ENSP00000364893	0.731	Rho guanine nucleotide exchange factor 7
18	9606.ENSP00000160827	0.730	Kinesin-like protein KIF22
19	9606.ENSP00000481917	0.721	Seizure 6-like protein 2
20	9606.ENSP00000256935	0.705	Dedicator of cytokinesis protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051015	0.998	actin filament binding
GO:0042802	0.997	identical protein binding
GO:1901363	0.346	heterocyclic compound binding
GO:0097159	0.343	organic cyclic compound binding
GO:0046983	0.310	protein dimerization activity
GO:0032036	0.309	myosin heavy chain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0048519	0.974	negative regulation of biological process
GO:0050896	0.966	response to stimulus
GO:0032970	0.959	regulation of actin filament-based process
GO:0048523	0.956	negative regulation of cellular process
GO:0030029	0.950	actin filament-based process
GO:0071840	0.940	cellular component organization or biogenesis
GO:0032501	0.936	multicellular organismal process
GO:0016043	0.934	cellular component organization
GO:1902903	0.916	regulation of supramolecular fiber organization
GO:0006996	0.910	organelle organization
GO:0045785	0.894	positive regulation of cell adhesion
GO:0110053	0.879	regulation of actin filament organization
GO:0030036	0.873	actin cytoskeleton organization
GO:2000145	0.825	regulation of cell motility
GO:0046649	0.809	lymphocyte activation
GO:0007015	0.804	actin filament organization
GO:0019222	0.796	regulation of metabolic process
GO:0048583	0.794	regulation of response to stimulus
GO:0002684	0.791	positive regulation of immune system process
GO:0006909	0.786	phagocytosis
GO:0007165	0.786	signal transduction
GO:0006950	0.766	response to stress
GO:0060255	0.754	regulation of macromolecule metabolic process
GO:0070887	0.695	cellular response to chemical stimulus
GO:0051125	0.693	regulation of actin nucleation
GO:0030334	0.690	regulation of cell migration
GO:0009605	0.681	response to external stimulus
GO:0023051	0.666	regulation of signaling
GO:0010646	0.666	regulation of cell communication
GO:0009966	0.664	regulation of signal transduction
GO:2000147	0.632	positive regulation of cell motility
GO:0006935	0.630	chemotaxis
GO:0030335	0.624	positive regulation of cell migration
GO:1902531	0.609	regulation of intracellular signal transduction
GO:0051239	0.598	regulation of multicellular organismal process
GO:0040013	0.581	negative regulation of locomotion
GO:0051641	0.564	cellular localization
GO:0071363	0.563	cellular response to growth factor stimulus
GO:0048870	0.524	cell motility
GO:0051649	0.506	establishment of localization in cell
GO:0044419	0.483	biological process involved in interspecies interaction between organisms
GO:0010639	0.453	negative regulation of organelle organization
GO:0016477	0.446	cell migration
GO:0051171	0.419	regulation of nitrogen compound metabolic process
GO:0048585	0.414	negative regulation of response to stimulus
GO:0031323	0.404	regulation of cellular metabolic process
GO:0080090	0.401	regulation of primary metabolic process
GO:0008152	0.318	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.995	membrane-bounded organelle
GO:0005737	0.995	cytoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0016020	0.994	membrane
GO:0031982	0.994	vesicle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0005856	0.994	cytoskeleton
GO:0071944	0.993	cell periphery
GO:0005829	0.990	cytosol
GO:0005576	0.986	extracellular region
GO:0012505	0.981	endomembrane system
GO:0031410	0.981	cytoplasmic vesicle
GO:0120025	0.980	plasma membrane bounded cell projection
GO:0070062	0.980	extracellular exosome
GO:0015629	0.979	actin cytoskeleton
GO:0005886	0.977	plasma membrane
GO:0032991	0.962	protein-containing complex
GO:0030027	0.941	lamellipodium
GO:0001772	0.921	immunological synapse
GO:0099513	0.916	polymeric cytoskeletal fiber
GO:0005884	0.867	actin filament
GO:0005938	0.529	cell cortex
GO:0030863	0.498	cortical cytoskeleton
GO:0030139	0.463	endocytic vesicle
GO:0030864	0.430	cortical actin cytoskeleton
GO:0001891	0.407	phagocytic cup
GO:0045335	0.407	phagocytic vesicle
GO:0031941	0.387	filamentous actin
GO:0032587	0.382	ruffle membrane
GO:0005634	0.381	nucleus
GO:0030054	0.368	cell junction
GO:0070161	0.351	anchoring junction
GO:0098871	0.344	postsynaptic actin cytoskeleton
GO:0043005	0.315	neuron projection
GO:0031090	0.311	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]