StarFunc result for job id P31151

User Input

>input (101 residues)
MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFE
KKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31151	1.000	1.000	4.845E-18	101	1.000	1.000	P31151.pdb.gz	S10A7_HUMAN Protein S100-A7 OS=Homo sapiens OX=9606 GN=S100A7 PE=1 SV=4
2	PDB:1psrA	0.967	0.977	2.928E-17	100	0.980	0.990	1psrA.pdb.gz
3	AFDB:Q5SY68	0.929	0.929	3.683E-11	101	0.525	0.525	Q5SY68.pdb.gz	S1A7B_HUMAN Protein S100-A7-like 2 OS=Homo sapiens OX=9606 GN=S100A7L2 PE=1 SV=1
4	AFDB:Q6S5I3	0.803	0.754	3.230E-6	108	0.297	0.278	Q6S5I3.pdb.gz	S115A_MOUSE Protein S100-A15A OS=Mus musculus OX=10090 GN=S100a15a PE=3 SV=1
5	AFDB:P31949	0.755	0.730	8.521E-6	105	0.317	0.305	P31949.pdb.gz	S10AB_HUMAN Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2
6	AFDB:P50116	0.787	0.709	1.177E-5	113	0.297	0.265	P50116.pdb.gz	S10A9_RAT Protein S100-A9 OS=Rattus norvegicus OX=10116 GN=S100a9 PE=1 SV=3
7	AFDB:P31725	0.791	0.711	1.525E-5	113	0.277	0.248	P31725.pdb.gz	S10A9_MOUSE Protein S100-A9 OS=Mus musculus OX=10090 GN=S100a9 PE=1 SV=3
8	AFDB:Q8WXG8	0.716	0.729	2.248E-5	99	0.248	0.253	Q8WXG8.pdb.gz	S100Z_HUMAN Protein S100-Z OS=Homo sapiens OX=9606 GN=S100Z PE=1 SV=4
9	AFDB:P27005	0.745	0.838	3.106E-5	89	0.218	0.247	P27005.pdb.gz	S10A8_MOUSE Protein S100-A8 OS=Mus musculus OX=10090 GN=S100a8 PE=1 SV=3
10	AFDB:P08207	0.776	0.806	3.535E-5	97	0.218	0.227	P08207.pdb.gz	S10AA_MOUSE Protein S100-A10 OS=Mus musculus OX=10090 GN=S100a10 PE=1 SV=2
11	PDB:6zdyA	0.784	0.736	3.728E-5	108	0.257	0.241	6zdyA.pdb.gz	Divalent cations influence the dimerization mode of murine S100A9 protein by modulating its disulfide bond pattern.
12	PDB:2lucA	0.771	0.744	4.828E-5	105	0.317	0.305	2lucA.pdb.gz
13	AFDB:P50115	0.747	0.840	5.559E-5	89	0.218	0.247	P50115.pdb.gz	S10A8_RAT Protein S100-A8 OS=Rattus norvegicus OX=10116 GN=S100a8 PE=1 SV=3
14	PDB:5hloC	0.711	0.767	1.049E-4	93	0.228	0.247	5hloC.pdb.gz	Crystal structure of human S100A8 in complex with zinc and calcium.
15	PDB:5csnA	0.709	0.758	2.280E-4	94	0.218	0.234	5csnA.pdb.gz	Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
16	PDB:7psqG	0.637	0.602	2.768E-4	108	0.228	0.213	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.
17	PDB:4hrgA	0.713	0.637	4.643E-4	114	0.198	0.175	4hrgA.pdb.gz	SMARCA3, a Chromatin-Remodeling Factor, Is Required for p11-Dependent Antidepressant Action.
18	PDB:1k96A	0.728	0.819	8.864E-4	89	0.198	0.225	1k96A.pdb.gz	Crystal structures of S100A6 in the Ca(2+)-free and Ca(2+)-bound states: the calcium sensor mechanism of S100 proteins revealed at atomic resolution.
19	PDB:2wc8D	0.662	0.712	2.192E-3	93	0.228	0.247	2wc8D.pdb.gz	The Crystal Structures of Human S100A12 in Apo Form and in Complex with Zinc: New Insights Into S100A12 Oligomerisation.
20	PDB:7nmiB	0.709	0.158	4.185E-3	488	0.248	0.051	7nmiB.pdb.gz	Transactivation domain of p53 in complex with S100P using annexin A2 as a crystallization chaperone

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31151	2.05e-72	211	101	1.000	1.000	S10A7_HUMAN Protein S100-A7 OS=Homo sapiens OX=9606 GN=S100A7 PE=1 SV=4
2	Q86SG5	1.57e-58	176	101	0.941	0.941	S1A7A_HUMAN Protein S100-A7A OS=Homo sapiens OX=9606 GN=S100A7A PE=1 SV=3
3	Q5SY68	8.46e-31	106	101	0.525	0.525	S1A7B_HUMAN Protein S100-A7-like 2 OS=Homo sapiens OX=9606 GN=S100A7L2 PE=1 SV=1
4	Q6S5I3	3.04e-13	62.4	108	0.317	0.296	S115A_MOUSE Protein S100-A15A OS=Mus musculus OX=10090 GN=S100a15a PE=3 SV=1
5	P50116	9.74e-13	61.2	113	0.317	0.283	S10A9_RAT Protein S100-A9 OS=Rattus norvegicus OX=10116 GN=S100a9 PE=1 SV=3
6	P31725	6.48e-09	51.2	113	0.277	0.248	S10A9_MOUSE Protein S100-A9 OS=Mus musculus OX=10090 GN=S100a9 PE=1 SV=3
7	P31949	2.74e-08	49.3	105	0.317	0.305	S10AB_HUMAN Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2
8	P80310	4.42e-08	48.5	92	0.267	0.293	S10AC_PIG Protein S100-A12 OS=Sus scrofa OX=9823 GN=S100A12 PE=1 SV=2
9	P80511	4.55e-07	45.8	92	0.238	0.261	S10AC_HUMAN Protein S100-A12 OS=Homo sapiens OX=9606 GN=S100A12 PE=1 SV=2
10	P50543	7.33e-07	45.4	98	0.277	0.286	S10AB_MOUSE Protein S100-A11 OS=Mus musculus OX=10090 GN=S100a11 PE=1 SV=1
11	P02638	3.20e-06	43.9	92	0.238	0.261	S100B_BOVIN Protein S100-B OS=Bos taurus OX=9913 GN=S100B PE=1 SV=2
12	P06702	4.44e-06	43.9	114	0.238	0.211	S10A9_HUMAN Protein S100-A9 OS=Homo sapiens OX=9606 GN=S100A9 PE=1 SV=1
13	P50114	7.93e-06	42.7	92	0.228	0.250	S100B_MOUSE Protein S100-B OS=Mus musculus OX=10090 GN=S100b PE=1 SV=2
14	Q8WXG8	7.99e-06	42.7	99	0.238	0.242	S100Z_HUMAN Protein S100-Z OS=Homo sapiens OX=9606 GN=S100Z PE=1 SV=4
15	P04631	1.13e-05	42.4	92	0.228	0.250	S100B_RAT Protein S100-B OS=Rattus norvegicus OX=10116 GN=S100b PE=1 SV=2
16	A0A0S2Z4C5	1.32e-05	42.4	92	0.228	0.250	A0A0S2Z4C5_HUMAN Protein S100 (Fragment) OS=Homo sapiens OX=9606 GN=S100B PE=2 SV=1
17	P04271	1.32e-05	42.4	92	0.228	0.250	S100B_HUMAN Protein S100-B OS=Homo sapiens OX=9606 GN=S100B PE=1 SV=2
18	P25815	4.82e-05	40.8	95	0.267	0.284	S100P_HUMAN Protein S100-P OS=Homo sapiens OX=9606 GN=S100P PE=1 SV=2
19	Q96FQ6	5.12e-05	40.8	103	0.267	0.262	S10AG_HUMAN Protein S100-A16 OS=Homo sapiens OX=9606 GN=S100A16 PE=1 SV=1
20	P29377	5.88e-05	40.0	79	0.238	0.304	S100G_HUMAN Protein S100-G OS=Homo sapiens OX=9606 GN=S100G PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12603 DUF3770	4.2e+02	11.8	Protein of unknown function (DUF3770)
2	PF00036 EF-hand_1	2.5	18.9	EF hand
3	PF13405 EF-hand_6	71	14.6	EF-hand domain
4	PF13499 EF-hand_7	21	17.0	EF-hand domain pair
5	PF05517 p25-alpha	4.9	18.8	p25-alpha
6	PF01023 S_100	1.8e-05	35.6	S-100/ICaBP type calcium binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357712

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350512	0.983	COP9 signalosome complex subunit 5
2	9606.ENSP00000283249	0.938	Integrin beta-6
3	9606.ENSP00000297258	0.911	Fatty acid-binding protein, epidermal
4	9606.ENSP00000357718	0.875	Protein S100-A7A
5	9606.ENSP00000298690	0.840	Ribonuclease 7
6	9606.ENSP00000303532	0.821	Defensin, beta 4A
7	9606.ENSP00000357697	0.780	Protein S100-A2
8	9606.ENSP00000357753	0.778	Involucrin
9	9606.ENSP00000364210	0.772	Advanced glycosylation end product-specific receptor
10	9606.ENSP00000360266	0.760	Transcription factor AP-1
11	9606.ENSP00000357726	0.730	Protein S100-A12
12	9606.ENSP00000324633	0.727	Beta-defensin 103
13	9606.ENSP00000320951	0.726	Defensin, beta 103A
14	9606.ENSP00000357801	0.713	Protein S100-A10
15	9606.ENSP00000296435	0.710	Cathelicidin antimicrobial peptide
16	9606.ENSP00000301653	0.686	Keratin, type I cytoskeletal 16
17	9606.ENSP00000424598	0.678	Beta-defensin 4A
18	9606.ENSP00000357702	0.669	Protein S100-A3
19	9606.ENSP00000357727	0.650	Protein S100-A9
20	9606.ENSP00000332163	0.646	Small proline-rich protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005509	1.000	calcium ion binding
GO:0005102	0.999	signaling receptor binding
GO:0008270	0.999	zinc ion binding
GO:0042802	0.525	identical protein binding
GO:0050786	0.453	RAGE receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.986	response to stimulus
GO:0044419	0.982	biological process involved in interspecies interaction between organisms
GO:0048583	0.981	regulation of response to stimulus
GO:0002376	0.961	immune system process
GO:0051707	0.961	response to other organism
GO:0006952	0.959	defense response
GO:0048518	0.956	positive regulation of biological process
GO:0098542	0.943	defense response to other organism
GO:0006955	0.942	immune response
GO:0048522	0.898	positive regulation of cellular process
GO:0048584	0.885	positive regulation of response to stimulus
GO:0023051	0.883	regulation of signaling
GO:0010646	0.883	regulation of cell communication
GO:0009987	0.879	cellular process
GO:0009966	0.855	regulation of signal transduction
GO:0006959	0.851	humoral immune response
GO:1902533	0.843	positive regulation of intracellular signal transduction
GO:0032101	0.822	regulation of response to external stimulus
GO:0030334	0.816	regulation of cell migration
GO:0019730	0.815	antimicrobial humoral response
GO:0042221	0.797	response to chemical
GO:0051179	0.790	localization
GO:0032502	0.736	developmental process
GO:0048856	0.734	anatomical structure development
GO:0002682	0.726	regulation of immune system process
GO:0002685	0.701	regulation of leukocyte migration
GO:0042742	0.690	defense response to bacterium
GO:0051235	0.665	maintenance of location
GO:0051238	0.661	sequestering of metal ion
GO:0040017	0.616	positive regulation of locomotion
GO:0071675	0.578	regulation of mononuclear cell migration
GO:0061844	0.550	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0002688	0.542	regulation of leukocyte chemotaxis
GO:0032103	0.537	positive regulation of response to external stimulus
GO:0071622	0.423	regulation of granulocyte chemotaxis
GO:2000401	0.377	regulation of lymphocyte migration
GO:2000147	0.374	positive regulation of cell motility
GO:0008544	0.355	epidermis development
GO:0002684	0.349	positive regulation of immune system process
GO:0030335	0.349	positive regulation of cell migration
GO:0019222	0.342	regulation of metabolic process
GO:0032501	0.330	multicellular organismal process
GO:0060255	0.322	regulation of macromolecule metabolic process
GO:0010033	0.308	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0070013	0.996	intracellular organelle lumen
GO:0005829	0.993	cytosol
GO:0012505	0.992	endomembrane system
GO:0005576	0.978	extracellular region
GO:0071944	0.974	cell periphery
GO:0005634	0.962	nucleus
GO:0031982	0.881	vesicle
GO:0005615	0.865	extracellular space
GO:0099503	0.763	secretory vesicle
GO:0030141	0.748	secretory granule
GO:0016020	0.637	membrane
GO:0062023	0.530	collagen-containing extracellular matrix
GO:0005886	0.523	plasma membrane
GO:0070062	0.387	extracellular exosome
GO:0034774	0.377	secretory granule lumen
GO:0031981	0.368	nuclear lumen
GO:0005654	0.364	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]