StarFunc result for job id P31249

User Input

>input (432 residues)
MLFEQGQQALELPECTMQKAAYYENPGLFGGYGYSKTTDTYGYSTPHQPYPPPAAASSLD
TDYPGSACSIQSSAPLRAPAHKGAELNGSCMRPGTGNSQGGGGGSQPPGLNSEQQPPQPP
PPPPTLPPSSPTNPGGGVPAKKPKGGPNASSSSATISKQIFPWMKESRQNSKQKNSCATA
GESCEDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKI
WFQNRRMKYKKDQKAKGILHSPASQSPERSPPLGGAAGHVAYSGQLPPVPGLAYDAPSPP
AFAKSQPNMYGLAAYTAPLSSCLPQQKRYAAPEFEPHPMASNGGGFASANLQGSPVYVGG
NFVESMAPASGPVFNLGHLSHPSSASVDYSCAAQIPGNHHHGPCDPHPTYTDLSAHHSSQ
GRLPEAPKLTHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09027	0.379	0.378	3.603E-55	433	0.958	0.956	P09027.pdb.gz	HXD3_MOUSE Homeobox protein Hox-D3 OS=Mus musculus OX=10090 GN=Hoxd3 PE=2 SV=4
2	AFDB:A0A024RA33	0.231	0.226	5.111E-24	443	0.532	0.519	A0A024RA33.pdb.gz
3	AFDB:P09026	0.188	0.187	4.493E-23	433	0.535	0.533	P09026.pdb.gz	HXB3_MOUSE Homeobox protein Hox-B3 OS=Mus musculus OX=10090 GN=Hoxb3 PE=2 SV=4
4	AFDB:P49639	0.182	0.228	1.754E-6	335	0.199	0.257	P49639.pdb.gz	HXA1_HUMAN Homeobox protein Hox-A1 OS=Homo sapiens OX=9606 GN=HOXA1 PE=1 SV=2
5	AFDB:Q504J3	0.172	0.226	5.739E-6	318	0.132	0.179	Q504J3.pdb.gz
6	AFDB:O42366	0.179	0.241	1.038E-5	311	0.160	0.222	O42366.pdb.gz	HXB1A_DANRE Homeobox protein Hox-B1a OS=Danio rerio OX=7955 GN=hoxb1a PE=2 SV=2
7	AFDB:A7Y7W3	0.169	0.227	1.878E-5	309	0.174	0.243	A7Y7W3.pdb.gz	NANOG_CHICK Homeobox protein NANOG OS=Gallus gallus OX=9031 GN=NANOG PE=1 SV=2
8	AFDB:Q6PFR9	0.159	0.164	2.611E-5	418	0.231	0.239	Q6PFR9.pdb.gz	Q6PFR9_DANRE Even-skipped homeobox 2 OS=Danio rerio OX=7955 GN=Evx-2 PE=2 SV=1
9	AFDB:Q54F46	0.149	0.085	3.876E-5	803	0.148	0.080	Q54F46.pdb.gz	WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum OX=44689 GN=warA PE=2 SV=1
10	AFDB:Q10328	0.133	0.065	1.041E-4	942	0.211	0.097	Q10328.pdb.gz	PHX1_SCHPO Homeobox transcription factor phx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=phx1 PE=3 SV=1
11	PDB:2hi3A	0.126	0.632	2.637E-2	73	0.037	0.219	2hi3A.pdb.gz
12	PDB:4egcA	0.108	0.087	4.771E-2	539	0.030	0.024	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:7fbyA	0.091	0.228	8.654E-1	153	0.021	0.059	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5aj0BZ	0.096	0.396	1.203	86	0.023	0.116	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:2cg4A	0.085	0.212	1.372	149	0.023	0.067	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
16	PDB:5nr5A	0.093	0.316	1.466	113	0.023	0.088	5nr5A.pdb.gz
17	PDB:5gadi	0.123	0.118	3.025	450	0.039	0.038	5gadi.pdb.gz	Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
18	PDB:5mrca	0.089	0.194	3.025	177	0.021	0.051	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
19	PDB:1yioA	0.082	0.163	3.451	198	0.019	0.040	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism
20	PDB:7awtE	0.063	0.144	3.686	156	0.021	0.058	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09027	0.0	741	433	0.944	0.942	HXD3_MOUSE Homeobox protein Hox-D3 OS=Mus musculus OX=10090 GN=Hoxd3 PE=2 SV=4
2	P31249	0.0	874	432	1.000	1.000	HXD3_HUMAN Homeobox protein Hox-D3 OS=Homo sapiens OX=9606 GN=HOXD3 PE=1 SV=3
3	P09026	2.21e-117	351	433	0.528	0.527	HXB3_MOUSE Homeobox protein Hox-B3 OS=Mus musculus OX=10090 GN=Hoxb3 PE=2 SV=4
4	P14651	3.26e-116	348	431	0.525	0.527	HXB3_HUMAN Homeobox protein Hox-B3 OS=Homo sapiens OX=9606 GN=HOXB3 PE=2 SV=2
5	P02831	3.10e-103	315	443	0.414	0.404	HXA3_MOUSE Homeobox protein Hox-A3 OS=Mus musculus OX=10090 GN=Hoxa3 PE=1 SV=2
6	O43365	6.81e-102	312	443	0.410	0.400	HXA3_HUMAN Homeobox protein Hox-A3 OS=Homo sapiens OX=9606 GN=HOXA3 PE=1 SV=1
7	Q8AWZ2	4.58e-93	288	410	0.454	0.478	HXA3A_DANRE Homeobox protein Hox-A3a OS=Danio rerio OX=7955 GN=hoxa3a PE=2 SV=1
8	C9J1M3	3.76e-65	206	100	0.231	1.000	C9J1M3_HUMAN Homeobox D3 (Fragment) OS=Homo sapiens OX=9606 GN=HOXD3 PE=1 SV=2
9	P31264	2.78e-30	125	782	0.120	0.066	HMPB_DROME Homeotic protein proboscipedia OS=Drosophila melanogaster OX=7227 GN=pb PE=2 SV=2
10	P31245	1.19e-29	120	372	0.162	0.188	HXA2_MOUSE Homeobox protein Hox-A2 OS=Mus musculus OX=10090 GN=Hoxa2 PE=2 SV=1
11	O43364	1.25e-29	120	376	0.160	0.184	HXA2_HUMAN Homeobox protein Hox-A2 OS=Homo sapiens OX=9606 GN=HOXA2 PE=1 SV=1
12	P31246	1.61e-29	120	372	0.157	0.183	HXA2_RAT Homeobox protein Hox-A2 OS=Rattus norvegicus OX=10116 GN=Hoxa2 PE=2 SV=1
13	P09013	2.85e-29	117	276	0.178	0.279	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
14	P0C1T1	1.01e-28	117	354	0.160	0.195	HXB2_MOUSE Homeobox protein Hox-B2 OS=Mus musculus OX=10090 GN=Hoxb2 PE=2 SV=1
15	P09014	2.79e-28	114	275	0.125	0.196	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
16	P09067	2.88e-28	114	269	0.125	0.201	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
17	P09079	2.91e-28	114	269	0.125	0.201	HXB5_MOUSE Homeobox protein Hox-B5 OS=Mus musculus OX=10090 GN=Hoxb5 PE=1 SV=3
18	P09092	3.80e-28	113	232	0.178	0.332	HXA6_MOUSE Homeobox protein Hox-A6 OS=Mus musculus OX=10090 GN=Hoxa6 PE=3 SV=2
19	P14652	6.41e-28	115	356	0.127	0.154	HXB2_HUMAN Homeobox protein Hox-B2 OS=Homo sapiens OX=9606 GN=HOXB2 PE=1 SV=1
20	P52947	1.07e-27	113	283	0.125	0.191	PDX1_RAT Pancreas/duodenum homeobox protein 1 OS=Rattus norvegicus OX=10116 GN=Pdx1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13293 DUF4074	1.6e-27	106.8	Domain of unknown function (DUF4074)
2	PF00046 Homeodomain	1e-17	75.0	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386498

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000249442	0.720	Metaxin-2
2	9606.ENSP00000302548	0.657	Homeobox protein Hox-D4
3	9606.ENSP00000371194	0.654	Lymphocyte-specific protein 1
4	9606.ENSP00000315949	0.591	Homeobox protein Hox-D8
5	9606.ENSP00000249499	0.573	Homeobox protein Hox-D9
6	9606.ENSP00000296591	0.538	EGF-like repeat and discoidin I-like domain-containing protein 3
7	9606.ENSP00000331268	0.524	Ankyrin repeat domain-containing protein 45

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140110	1.000	transcription regulator activity
GO:0005515	1.000	protein binding
GO:0000976	0.995	transcription cis-regulatory region binding
GO:0000977	0.988	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003700	0.974	DNA-binding transcription factor activity
GO:0000981	0.914	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001216	0.774	DNA-binding transcription activator activity
GO:0000987	0.449	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.430	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.320	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009889	0.986	regulation of biosynthetic process
GO:0060255	0.984	regulation of macromolecule metabolic process
GO:0051171	0.941	regulation of nitrogen compound metabolic process
GO:0032501	0.939	multicellular organismal process
GO:0080090	0.939	regulation of primary metabolic process
GO:0048856	0.938	anatomical structure development
GO:0010468	0.932	regulation of gene expression
GO:0007275	0.930	multicellular organism development
GO:0031323	0.929	regulation of cellular metabolic process
GO:0048522	0.909	positive regulation of cellular process
GO:0019219	0.905	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.887	regulation of macromolecule biosynthetic process
GO:0048731	0.858	system development
GO:2001141	0.841	regulation of RNA biosynthetic process
GO:0006355	0.817	regulation of DNA-templated transcription
GO:0009987	0.730	cellular process
GO:0006357	0.687	regulation of transcription by RNA polymerase II
GO:0009893	0.670	positive regulation of metabolic process
GO:0010604	0.553	positive regulation of macromolecule metabolic process
GO:0051173	0.546	positive regulation of nitrogen compound metabolic process
GO:0031325	0.538	positive regulation of cellular metabolic process
GO:0048513	0.530	animal organ development
GO:0009653	0.521	anatomical structure morphogenesis
GO:0007399	0.443	nervous system development
GO:0050896	0.347	response to stimulus
GO:0045935	0.319	positive regulation of nucleobase-containing compound metabolic process
GO:0048519	0.312	negative regulation of biological process
GO:0009891	0.305	positive regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.472	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]