StarFunc result for job id P31260

User Input

>input (410 residues)
MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAH
GGVYLPPAADLPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLD
APRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPK
VSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGAQQLGAGP
FPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAE
ELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMY
LTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31310	0.370	0.366	1.221E-45	416	0.917	0.904	P31310.pdb.gz	HXA10_MOUSE Homeobox protein Hox-A10 OS=Mus musculus OX=10090 GN=Hoxa10 PE=1 SV=4
2	AFDB:P82976	0.157	0.154	4.091E-6	418	0.251	0.246	P82976.pdb.gz	GBX1_MOUSE Homeobox protein GBX-1 OS=Mus musculus OX=10090 GN=Gbx1 PE=2 SV=2
3	AFDB:P10105	0.171	0.113	2.036E-5	635	0.232	0.150	P10105.pdb.gz	LAB_DROME Homeotic protein labial OS=Drosophila melanogaster OX=7227 GN=lab PE=1 SV=2
4	PDB:4egcA	0.117	0.089	1.447E-2	539	0.032	0.024	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
5	PDB:2hi3A	0.128	0.609	1.405E-1	73	0.037	0.205	2hi3A.pdb.gz
6	AFDB:Q91YU6	0.075	0.048	2.708E-1	671	0.183	0.112	Q91YU6.pdb.gz	LZTS2_MOUSE Leucine zipper putative tumor suppressor 2 OS=Mus musculus OX=10090 GN=Lzts2 PE=1 SV=3
7	AFDB:B3H7M2	0.094	0.076	3.096E-1	525	0.183	0.143	B3H7M2.pdb.gz	B3H7M2_ARATH Basic-leucine zipper (BZIP) transcription factor family protein OS=Arabidopsis thaliana OX=3702 GN=BZIP30 PE=1 SV=1
8	AFDB:O14148	0.082	0.026	5.651E-1	1604	0.144	0.037	O14148.pdb.gz	INO80_SCHPO Chromatin-remodeling ATPase INO80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ino80 PE=1 SV=4
9	AFDB:Q08AD1	0.082	0.032	9.649E-1	1489	0.161	0.044	Q08AD1.pdb.gz	CAMP2_HUMAN Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3
10	AFDB:Q9U9A9	0.078	0.031	1.032	1100	0.176	0.065	Q9U9A9.pdb.gz	Q9U9A9_DROME Tuberous sclerosis gene product-1 homolog OS=Drosophila melanogaster OX=7227 GN=Tsc1 PE=2 SV=1
11	PDB:5nr5A	0.094	0.309	1.117	113	0.020	0.071	5nr5A.pdb.gz
12	PDB:7fbyA	0.103	0.242	1.117	153	0.022	0.059	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
13	AFDB:A0A060VZ42	0.084	0.063	1.348	579	0.205	0.145	A0A060VZ42.pdb.gz	A0A060VZ42_ONCMY Nucleoporin NSP1-like C-terminal domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00081146001 PE=3 SV=1
14	AFDB:F6Y6H6	0.085	0.079	1.647	449	0.129	0.118	F6Y6H6.pdb.gz	F6Y6H6_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 PE=1 SV=2
15	PDB:4ldzA	0.105	0.196	1.784	196	0.032	0.066	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
16	PDB:2cg4A	0.095	0.234	2.664	149	0.015	0.040	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:6dv9F	0.067	0.137	2.664	174	0.022	0.052	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
18	PDB:2cyyA	0.093	0.217	3.481	151	0.024	0.066	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
19	PDB:5aj0BZ	0.103	0.405	3.722	86	0.032	0.151	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
20	PDB:2cjjA	0.125	0.683	3.980	63	0.024	0.159	2cjjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31260	0.0	815	410	1.000	1.000	HXA10_HUMAN Homeobox protein Hox-A10 OS=Homo sapiens OX=9606 GN=HOXA10 PE=1 SV=3
2	P31310	0.0	586	416	0.876	0.863	HXA10_MOUSE Homeobox protein Hox-A10 OS=Mus musculus OX=10090 GN=Hoxa10 PE=1 SV=4
3	P28358	3.87e-84	262	340	0.427	0.515	HXD10_HUMAN Homeobox protein Hox-D10 OS=Homo sapiens OX=9606 GN=HOXD10 PE=1 SV=2
4	P28359	8.70e-84	261	340	0.427	0.515	HXD10_MOUSE Homeobox protein Hox-D10 OS=Mus musculus OX=10090 GN=Hoxd10 PE=1 SV=2
5	P31257	6.91e-65	213	342	0.376	0.450	HXC10_MOUSE Homeobox protein Hox-C10 OS=Mus musculus OX=10090 GN=Hoxc10 PE=2 SV=1
6	Q53XI4	1.30e-64	212	342	0.376	0.450	Q53XI4_HUMAN Homeo box C10 OS=Homo sapiens OX=9606 GN=HOXC10 PE=2 SV=1
7	Q9NYD6	1.30e-64	212	342	0.376	0.450	HXC10_HUMAN Homeobox protein Hox-C10 OS=Homo sapiens OX=9606 GN=HOXC10 PE=1 SV=2
8	A0A669KBC8	3.96e-36	133	213	0.137	0.263	A0A669KBC8_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
9	A0A669K9T0	8.95e-36	133	225	0.137	0.249	A0A669K9T0_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
10	D3ZSU5	2.31e-35	133	271	0.137	0.207	D3ZSU5_RAT Homeobox protein OS=Rattus norvegicus OX=10116 GN=Hoxa9 PE=3 SV=1
11	P09631	2.67e-35	133	271	0.137	0.207	HXA9_MOUSE Homeobox protein Hox-A9 OS=Mus musculus OX=10090 GN=Hoxa9 PE=1 SV=2
12	P31269	2.82e-35	133	272	0.137	0.206	HXA9_HUMAN Homeobox protein Hox-A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=4
13	P20615	6.49e-35	131	250	0.134	0.220	HXB9_MOUSE Homeobox protein Hox-B9 OS=Mus musculus OX=10090 GN=Hoxb9 PE=2 SV=3
14	P17482	7.74e-35	131	250	0.134	0.220	HXB9_HUMAN Homeobox protein Hox-B9 OS=Homo sapiens OX=9606 GN=HOXB9 PE=1 SV=2
15	P28357	6.61e-29	117	339	0.120	0.145	HXD9_MOUSE Homeobox protein Hox-D9 OS=Mus musculus OX=10090 GN=Hoxd9 PE=2 SV=1
16	P28356	7.80e-29	117	352	0.120	0.139	HXD9_HUMAN Homeobox protein Hox-D9 OS=Homo sapiens OX=9606 GN=HOXD9 PE=1 SV=5
17	P09633	2.58e-28	114	260	0.141	0.223	HXC9_MOUSE Homeobox protein Hox-C9 OS=Mus musculus OX=10090 GN=Hoxc9 PE=2 SV=2
18	P31274	3.00e-28	114	260	0.127	0.200	HXC9_HUMAN Homeobox protein Hox-C9 OS=Homo sapiens OX=9606 GN=HOXC9 PE=1 SV=3
19	Q9YGS6	9.85e-28	112	260	0.124	0.196	HXC9A_DANRE Homeobox protein Hox-C9a OS=Danio rerio OX=7955 GN=hoxc9a PE=2 SV=2
20	P31277	1.37e-26	111	338	0.115	0.139	HXD11_HUMAN Homeobox protein Hox-D11 OS=Homo sapiens OX=9606 GN=HOXD11 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	4.7e+02	12.1	Homeobox KN domain
2	PF00046 Homeodomain	9.1e-17	72.0	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283921

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000249396	0.979	NAD-dependent protein deacetylase sirtuin-2
2	9606.ENSP00000364190	0.953	Pre-B-cell leukemia transcription factor 2
3	9606.ENSP00000405890	0.886	Pre-B-cell leukemia transcription factor 1
4	9606.ENSP00000343619	0.856	Homeobox protein Hox-A9
5	9606.ENSP00000272369	0.827	Homeobox protein Meis1
6	9606.ENSP00000368880	0.692	Forkhead box protein O1
7	9606.ENSP00000222726	0.676	Homeobox protein Hox-A5
8	9606.ENSP00000262367	0.650	CREB-binding protein
9	9606.ENSP00000342235	0.633	Receptor tyrosine-protein kinase erbB-4
10	9606.ENSP00000362588	0.632	Pre-B-cell leukemia transcription factor 3
11	9606.ENSP00000405330	0.614	Estrogen receptor
12	9606.ENSP00000395389	0.595	Lysophosphatidic acid receptor 3
13	9606.ENSP00000006015	0.594	Homeobox protein Hox-A11
14	9606.ENSP00000222718	0.590	Homeobox protein Hox-A2
15	9606.ENSP00000356436	0.577	Cytosolic phospholipase A2
16	9606.ENSP00000227163	0.572	Transcription factor PU.1
17	9606.ENSP00000222753	0.566	Homeobox protein Hox-A13
18	9606.ENSP00000320147	0.561	Histone-lysine N-methyltransferase EZH2
19	9606.ENSP00000316032	0.556	Nuclear pore complex protein Nup98-Nup96
20	9606.ENSP00000348769	0.556	E3 ubiquitin-protein ligase ARIH2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	0.998	sequence-specific DNA binding
GO:1990837	0.988	sequence-specific double-stranded DNA binding
GO:0003700	0.972	DNA-binding transcription factor activity
GO:0005515	0.963	protein binding
GO:0000981	0.905	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.888	transcription cis-regulatory region binding
GO:0000977	0.559	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031326	0.991	regulation of cellular biosynthetic process
GO:0051252	0.987	regulation of RNA metabolic process
GO:0032502	0.982	developmental process
GO:0006355	0.980	regulation of DNA-templated transcription
GO:0032501	0.969	multicellular organismal process
GO:0048518	0.930	positive regulation of biological process
GO:0006357	0.927	regulation of transcription by RNA polymerase II
GO:0048522	0.920	positive regulation of cellular process
GO:0048856	0.888	anatomical structure development
GO:0010604	0.869	positive regulation of macromolecule metabolic process
GO:0009987	0.851	cellular process
GO:0007275	0.822	multicellular organism development
GO:0031325	0.812	positive regulation of cellular metabolic process
GO:0051173	0.790	positive regulation of nitrogen compound metabolic process
GO:0019953	0.721	sexual reproduction
GO:0007276	0.711	gamete generation
GO:0048232	0.691	male gamete generation
GO:0048513	0.641	animal organ development
GO:0045935	0.637	positive regulation of nucleobase-containing compound metabolic process
GO:0048731	0.635	system development
GO:0009891	0.580	positive regulation of biosynthetic process
GO:0051254	0.575	positive regulation of RNA metabolic process
GO:0045893	0.541	positive regulation of DNA-templated transcription
GO:0048519	0.526	negative regulation of biological process
GO:0045944	0.467	positive regulation of transcription by RNA polymerase II
GO:0003006	0.453	developmental process involved in reproduction
GO:0048523	0.395	negative regulation of cellular process
GO:0007283	0.360	spermatogenesis
GO:0009892	0.313	negative regulation of metabolic process
GO:0009653	0.303	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.990	cytoplasm
GO:0032991	0.988	protein-containing complex
GO:0005667	0.471	transcription regulator complex
GO:0005829	0.406	cytosol
GO:0043232	0.340	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]