StarFunc result for job id P31267

User Input

>input (233 residues)
MSSYFVNPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQ
SNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQG
KALHDEGADRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYL
TRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSEAKAGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31267	1.000	1.000	1.340E-33	233	1.000	1.000	P31267.pdb.gz	HXA6_HUMAN Homeobox protein Hox-A6 OS=Homo sapiens OX=9606 GN=HOXA6 PE=2 SV=2
2	AFDB:P31268	0.393	0.398	8.871E-12	230	0.416	0.422	P31268.pdb.gz	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
3	AFDB:P09013	0.337	0.285	9.321E-11	276	0.378	0.319	P09013.pdb.gz	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
4	AFDB:P09014	0.367	0.315	1.792E-10	275	0.382	0.324	P09014.pdb.gz	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
5	AFDB:Q68EH7	0.306	0.289	2.180E-10	250	0.373	0.348	Q68EH7.pdb.gz	HXC8A_DANRE Homeobox protein Hox-C8a OS=Danio rerio OX=7955 GN=hoxc8a PE=2 SV=1
6	AFDB:P09077	0.380	0.222	2.327E-10	417	0.378	0.211	P09077.pdb.gz	SCR_DROME Homeotic protein Sex combs reduced OS=Drosophila melanogaster OX=7227 GN=Scr PE=1 SV=5
7	AFDB:A0A024RB51	0.367	0.327	4.189E-10	264	0.322	0.284	A0A024RB51.pdb.gz
8	AFDB:O57374	0.339	0.335	5.440E-10	236	0.309	0.305	O57374.pdb.gz	HXD4A_DANRE Homeobox protein Hox-D4a OS=Danio rerio OX=7955 GN=hoxd4a PE=2 SV=2
9	AFDB:F1RBA3	0.356	0.339	7.542E-10	246	0.326	0.309	F1RBA3.pdb.gz
10	AFDB:P52946	0.324	0.269	2.786E-9	284	0.292	0.239	P52946.pdb.gz	PDX1_MOUSE Pancreas/duodenum homeobox protein 1 OS=Mus musculus OX=10090 GN=Pdx1 PE=1 SV=1
11	PDB:4egcA	0.202	0.091	1.062E-2	539	0.064	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.203	0.585	1.792E-2	73	0.094	0.301	2hi3A.pdb.gz
13	PDB:7fbyA	0.158	0.228	1.029	153	0.030	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5mrca	0.159	0.198	1.252	177	0.073	0.096	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
15	PDB:5nr5A	0.167	0.321	1.252	113	0.047	0.097	5nr5A.pdb.gz
16	PDB:2cg4A	0.151	0.222	2.112	149	0.039	0.060	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:6dv9F	0.148	0.197	2.112	174	0.056	0.075	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
18	PDB:5z56L	0.174	0.124	2.407	342	0.043	0.029	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
19	PDB:7w59R	0.099	0.083	2.407	280	0.073	0.061	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
20	PDB:1yioA	0.142	0.163	2.569	198	0.039	0.045	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31267	2.65e-176	485	233	1.000	1.000	HXA6_HUMAN Homeobox protein Hox-A6 OS=Homo sapiens OX=9606 GN=HOXA6 PE=2 SV=2
2	P09092	1.55e-167	462	232	0.961	0.966	HXA6_MOUSE Homeobox protein Hox-A6 OS=Mus musculus OX=10090 GN=Hoxa6 PE=3 SV=2
3	P09023	9.58e-77	233	224	0.571	0.594	HXB6_MOUSE Homeobox protein Hox-B6 OS=Mus musculus OX=10090 GN=Hoxb6 PE=1 SV=2
4	P17509	2.92e-76	231	224	0.567	0.589	HXB6_HUMAN Homeobox protein Hox-B6 OS=Homo sapiens OX=9606 GN=HOXB6 PE=1 SV=4
5	P09630	1.75e-65	204	235	0.476	0.472	HXC6_HUMAN Homeobox protein Hox-C6 OS=Homo sapiens OX=9606 GN=HOXC6 PE=2 SV=3
6	P10629	1.75e-65	204	235	0.476	0.472	HXC6_MOUSE Homeobox protein Hox-C6 OS=Mus musculus OX=10090 GN=Hoxc6 PE=2 SV=2
7	P20719	3.30e-40	140	270	0.275	0.237	HXA5_HUMAN Homeobox protein Hox-A5 OS=Homo sapiens OX=9606 GN=HOXA5 PE=1 SV=2
8	P09021	4.09e-40	140	270	0.258	0.222	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
9	P09067	1.19e-38	137	269	0.258	0.223	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
10	P09079	1.21e-38	137	269	0.258	0.223	HXB5_MOUSE Homeobox protein Hox-B5 OS=Mus musculus OX=10090 GN=Hoxb5 PE=1 SV=3
11	P09013	1.78e-38	136	276	0.258	0.217	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
12	P02833	1.89e-38	139	378	0.292	0.180	ANTP_DROME Homeotic protein antennapedia OS=Drosophila melanogaster OX=7227 GN=Antp PE=1 SV=1
13	P09014	2.04e-38	136	275	0.253	0.215	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
14	P52949	8.91e-38	133	233	0.245	0.245	HXA5_RAT Homeobox protein Hox-A5 (Fragment) OS=Rattus norvegicus OX=10116 GN=Hoxa5 PE=2 SV=1
15	P02830	9.31e-38	133	229	0.266	0.271	HXA7_MOUSE Homeobox protein Hox-A7 OS=Mus musculus OX=10090 GN=Hoxa7 PE=2 SV=2
16	P09629	1.17e-37	132	217	0.262	0.281	HXB7_HUMAN Homeobox protein Hox-B7 OS=Homo sapiens OX=9606 GN=HOXB7 PE=1 SV=4
17	P09024	3.21e-37	131	217	0.262	0.281	HXB7_MOUSE Homeobox protein Hox-B7 OS=Mus musculus OX=10090 GN=Hoxb7 PE=1 SV=2
18	P31268	3.47e-37	132	230	0.266	0.270	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
19	P06798	7.48e-37	132	285	0.288	0.235	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
20	P09077	8.78e-37	135	417	0.283	0.158	SCR_DROME Homeotic protein Sex combs reduced OS=Drosophila melanogaster OX=7227 GN=Scr PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	4.1e-18	76.3	Homeodomain
2	PF18168 PPL5	2.1e+02	12.6	Prim-pol family 5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010386609.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010386607.1	0.786	Homeobox A7
2	61622.XP_010386610.1	0.776	Homeobox protein Hox-A5
3	61622.XP_010372174.1	0.756	Homeobox protein Hox-C4
4	61622.XP_010372178.1	0.746	Homeobox C5
5	61622.XP_010357917.1	0.745	Homeobox B5
6	61622.XP_010380617.1	0.745	Homeobox protein Hox-D4
7	61622.XP_010357728.1	0.739	Homeobox protein Hox-B4
8	61622.XP_010357938.1	0.738	Homeobox protein Hox-B7
9	61622.XP_010372175.1	0.735	Homeobox protein Hox-C6 isoform X1
10	61622.XP_010357901.1	0.733	Homeobox protein Hox-B6
11	61622.XP_010372181.1	0.707	Homeobox protein Hox-C10
12	61622.XP_010371661.1	0.506	PBX homeobox 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.981	protein binding
GO:0003700	0.932	DNA-binding transcription factor activity
GO:0000976	0.703	transcription cis-regulatory region binding
GO:0000977	0.637	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.626	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007389	0.989	pattern specification process
GO:0009790	0.986	embryo development
GO:0001501	0.968	skeletal system development
GO:0003002	0.942	regionalization
GO:0048706	0.856	embryonic skeletal system development
GO:0009952	0.835	anterior/posterior pattern specification
GO:0050789	0.611	regulation of biological process
GO:0050794	0.586	regulation of cellular process
GO:0009653	0.449	anatomical structure morphogenesis
GO:0060255	0.436	regulation of macromolecule metabolic process
GO:0010468	0.434	regulation of gene expression
GO:0009987	0.405	cellular process
GO:0006355	0.391	regulation of DNA-templated transcription
GO:0006357	0.370	regulation of transcription by RNA polymerase II
GO:0048518	0.333	positive regulation of biological process
GO:0010604	0.317	positive regulation of macromolecule metabolic process
GO:0048522	0.310	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.815	nuclear body
GO:0016607	0.549	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]