StarFunc result for job id P31268

User Input

>input (230 residues)
MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSP
LYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIY
PWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQN
RRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDEEEEDEEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31268	1.000	1.000	7.055E-33	230	1.000	1.000	P31268.pdb.gz	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
2	AFDB:P09024	0.365	0.385	3.430E-18	217	0.548	0.581	P09024.pdb.gz	HXB7_MOUSE Homeobox protein Hox-B7 OS=Mus musculus OX=10090 GN=Hoxb7 PE=1 SV=2
3	AFDB:P09630	0.366	0.359	3.673E-13	235	0.378	0.370	P09630.pdb.gz	HXC6_HUMAN Homeobox protein Hox-C6 OS=Homo sapiens OX=9606 GN=HOXC6 PE=2 SV=3
4	AFDB:P31267	0.388	0.384	8.803E-12	233	0.413	0.408	P31267.pdb.gz	HXA6_HUMAN Homeobox protein Hox-A6 OS=Homo sapiens OX=9606 GN=HOXA6 PE=2 SV=2
5	AFDB:P09632	0.349	0.333	2.081E-11	243	0.396	0.374	P09632.pdb.gz	HXB8_MOUSE Homeobox protein Hox-B8 OS=Mus musculus OX=10090 GN=Hoxb8 PE=1 SV=2
6	AFDB:P09016	0.325	0.295	5.256E-11	255	0.357	0.322	P09016.pdb.gz	HXD4_HUMAN Homeobox protein Hox-D4 OS=Homo sapiens OX=9606 GN=HOXD4 PE=1 SV=3
7	AFDB:P09013	0.339	0.286	2.408E-10	276	0.365	0.304	P09013.pdb.gz	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
8	AFDB:P13378	0.339	0.273	3.138E-10	290	0.339	0.269	P13378.pdb.gz	HXD8_HUMAN Homeobox protein Hox-D8 OS=Homo sapiens OX=9606 GN=HOXD8 PE=1 SV=2
9	AFDB:A5PLE8	0.318	0.289	1.033E-9	255	0.296	0.267	A5PLE8.pdb.gz	A5PLE8_DANRE Caudal type homeobox 1 b OS=Danio rerio OX=7955 GN=zgc:165581 PE=2 SV=1
10	AFDB:P49639	0.317	0.223	5.056E-9	335	0.309	0.212	P49639.pdb.gz	HXA1_HUMAN Homeobox protein Hox-A1 OS=Homo sapiens OX=9606 GN=HOXA1 PE=1 SV=2
11	PDB:4egcA	0.219	0.094	8.206E-3	539	0.065	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.210	0.595	4.017E-2	73	0.074	0.233	2hi3A.pdb.gz
13	PDB:7fbyA	0.171	0.240	9.011E-1	153	0.030	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5nr5A	0.169	0.320	2.276	113	0.061	0.124	5nr5A.pdb.gz
15	PDB:2cg4A	0.160	0.231	2.598	149	0.039	0.060	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
16	PDB:1yioA	0.143	0.163	2.776	198	0.039	0.045	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism
17	PDB:4v88Ah	0.100	0.141	2.776	159	0.096	0.138	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
18	PDB:6dv9F	0.149	0.196	2.966	174	0.048	0.063	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
19	PDB:2cjjA	0.219	0.689	3.169	63	0.039	0.143	2cjjA.pdb.gz
20	PDB:2vbwA	0.133	0.187	3.169	147	0.048	0.075	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31268	9.49e-174	478	230	1.000	1.000	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
2	P02830	3.89e-147	411	229	0.870	0.873	HXA7_MOUSE Homeobox protein Hox-A7 OS=Mus musculus OX=10090 GN=Hoxa7 PE=2 SV=2
3	P09024	2.83e-81	244	217	0.574	0.608	HXB7_MOUSE Homeobox protein Hox-B7 OS=Mus musculus OX=10090 GN=Hoxb7 PE=1 SV=2
4	P09629	7.10e-80	240	217	0.565	0.599	HXB7_HUMAN Homeobox protein Hox-B7 OS=Homo sapiens OX=9606 GN=HOXB7 PE=1 SV=4
5	I3L3R1	3.51e-42	145	242	0.426	0.405	I3L3R1_HUMAN Homeobox B8 OS=Homo sapiens OX=9606 GN=HOXB8 PE=1 SV=1
6	P02833	7.74e-42	147	378	0.291	0.177	ANTP_DROME Homeotic protein antennapedia OS=Drosophila melanogaster OX=7227 GN=Antp PE=1 SV=1
7	Q8AWZ0	1.00e-41	144	245	0.417	0.392	HXB8A_DANRE Homeobox protein Hox-B8a OS=Danio rerio OX=7955 GN=hoxb8a PE=2 SV=1
8	Q68EH7	1.01e-40	141	250	0.435	0.400	HXC8A_DANRE Homeobox protein Hox-C8a OS=Danio rerio OX=7955 GN=hoxc8a PE=2 SV=1
9	P17481	1.59e-40	140	243	0.426	0.403	HXB8_HUMAN Homeobox protein Hox-B8 OS=Homo sapiens OX=9606 GN=HOXB8 PE=1 SV=2
10	P31273	1.82e-40	140	242	0.430	0.409	HXC8_HUMAN Homeobox protein Hox-C8 OS=Homo sapiens OX=9606 GN=HOXC8 PE=1 SV=2
11	P09023	2.98e-40	139	224	0.435	0.446	HXB6_MOUSE Homeobox protein Hox-B6 OS=Mus musculus OX=10090 GN=Hoxb6 PE=1 SV=2
12	P17509	3.11e-40	139	224	0.435	0.446	HXB6_HUMAN Homeobox protein Hox-B6 OS=Homo sapiens OX=9606 GN=HOXB6 PE=1 SV=4
13	P09013	3.69e-40	140	276	0.278	0.232	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
14	P09014	5.06e-40	140	275	0.278	0.233	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
15	P09067	5.94e-40	140	269	0.278	0.238	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
16	P09079	6.34e-40	140	269	0.278	0.238	HXB5_MOUSE Homeobox protein Hox-B5 OS=Mus musculus OX=10090 GN=Hoxb5 PE=1 SV=3
17	P09025	7.69e-40	139	242	0.426	0.405	HXC8_MOUSE Homeobox protein Hox-C8 OS=Mus musculus OX=10090 GN=Hoxc8 PE=1 SV=2
18	P20719	9.77e-40	139	270	0.283	0.241	HXA5_HUMAN Homeobox protein Hox-A5 OS=Homo sapiens OX=9606 GN=HOXA5 PE=1 SV=2
19	P09021	1.03e-39	139	270	0.283	0.241	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
20	P09630	1.68e-39	137	235	0.378	0.370	HXC6_HUMAN Homeobox protein Hox-C6 OS=Homo sapiens OX=9606 GN=HOXC6 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	3.4e-18	76.6	Homeodomain
2	PF00428 Ribosomal_60s	1.3e+02	14.6	60s Acidic ribosomal protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242159

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000427514	0.925	CCAAT/enhancer-binding protein alpha
2	9606.ENSP00000360266	0.917	Transcription factor AP-1
3	9606.ENSP00000306245	0.916	Proto-oncogene c-Fos
4	9606.ENSP00000376436	0.911	Protein C-ets-1
5	9606.ENSP00000353344	0.907	Protein C-ets-2
6	9606.ENSP00000329357	0.904	Transcription factor Sp1
7	9606.ENSP00000222728	0.889	Homeobox protein Hox-A6
8	9606.ENSP00000222726	0.882	Homeobox protein Hox-A5
9	9606.ENSP00000272369	0.861	Homeobox protein Meis1
10	9606.ENSP00000239151	0.847	Homeobox protein Hox-B5
11	9606.ENSP00000420009	0.844	Homeobox protein Hox-B6
12	9606.ENSP00000243108	0.841	Homeobox protein Hox-C6
13	9606.ENSP00000328928	0.841	Homeobox protein Hox-B4
14	9606.ENSP00000302548	0.840	Homeobox protein Hox-D4
15	9606.ENSP00000309336	0.835	Homeobox protein Hox-C5
16	9606.ENSP00000399808	0.833	Homeobox protein Hox-C4
17	9606.ENSP00000239165	0.826	Homeobox protein Hox-B7
18	9606.ENSP00000476742	0.810	Uncharacterized protein
19	9606.ENSP00000405890	0.718	Pre-B-cell leukemia transcription factor 1
20	9606.ENSP00000436786	0.699	Histone-lysine N-methyltransferase 2A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	0.998	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.998	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.995	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.988	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.970	transcription factor binding
GO:0140297	0.760	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.991	regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0051171	0.979	regulation of nitrogen compound metabolic process
GO:0009889	0.978	regulation of biosynthetic process
GO:0010468	0.978	regulation of gene expression
GO:0007275	0.973	multicellular organism development
GO:0048522	0.928	positive regulation of cellular process
GO:0080090	0.925	regulation of primary metabolic process
GO:0031323	0.925	regulation of cellular metabolic process
GO:0006355	0.918	regulation of DNA-templated transcription
GO:0051173	0.907	positive regulation of nitrogen compound metabolic process
GO:0006357	0.901	regulation of transcription by RNA polymerase II
GO:0031325	0.893	positive regulation of cellular metabolic process
GO:1903508	0.875	positive regulation of nucleic acid-templated transcription
GO:0045893	0.853	positive regulation of DNA-templated transcription
GO:0048519	0.799	negative regulation of biological process
GO:0009987	0.708	cellular process
GO:0045944	0.651	positive regulation of transcription by RNA polymerase II
GO:0048523	0.476	negative regulation of cellular process
GO:0048731	0.382	system development
GO:0009892	0.354	negative regulation of metabolic process
GO:0031324	0.340	negative regulation of cellular metabolic process
GO:0051172	0.339	negative regulation of nitrogen compound metabolic process
GO:0010605	0.309	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0012505	0.457	endomembrane system
GO:0016020	0.332	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]